BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0510.0010.p (134 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE11262.1| YngA protein [Bacillus amyloliquefaciens] 85 6e-16 ref|NP_389699.1| yngA [Bacillus subtilis] >gi|7475202|pir||F6989... 81 9e-15 ref|NP_905154.1| GtrA family protein [Porphyromonas gingivalis W... 64 1e-09 ref|NP_653901.1| hypothetical protein predicted by GeneMark [Bac... 63 3e-09 ref|NP_347648.1| Uncharacterized membrane protein, homolog of YN... 62 3e-09 >emb|CAE11262.1| YngA protein [Bacillus amyloliquefaciens] Length = 135 Score = 84.7 bits (208), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 47/120 (39%), Positives = 68/120 (56%), Gaps = 6/120 (5%) Query: 15 KFNAVGVLNTLIDFAIFTLLHSLGMMNAPAQIISYSAGTANSFIWNKKVTFRDRDRGSKD 74 +F VGV NTLIDF +F LL + + PAQI SYSAG NS++WN+K TFR + + Sbjct: 11 RFCTVGVGNTLIDFGVFFLLAACHVPYLPAQICSYSAGIINSYVWNRKWTFRVKRKA--- 67 Query: 75 SFDRMQLVRFIVLNLVVLGISVLLMHLLTGRFGIQXXXXXXXXXXXXXXINFFGSRKWVF 134 D +++RF+++NL GI+ LL++ + G +NF G+R WVF Sbjct: 68 --DGKEIMRFVMINLAASGITFLLLYAFQ-KGGCSLLVSKFAATIGGMMMNFIGNRIWVF 124 >ref|NP_389699.1| yngA [Bacillus subtilis] pir||F69892 hypothetical protein yngA - Bacillus subtilis emb|CAB13700.1| yngA [Bacillus subtilis subsp. subtilis str. 168] Length = 148 Score = 80.9 bits (198), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 45/120 (37%), Positives = 66/120 (55%), Gaps = 6/120 (5%) Query: 15 KFNAVGVLNTLIDFAIFTLLHSLGMMNAPAQIISYSAGTANSFIWNKKVTFRDRDRGSKD 74 +F VGV NTLIDF +F LL + + PAQI SY+AG NS++WN+ TF + + Sbjct: 24 RFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTAGIVNSYVWNRNWTFCVKRKA--- 80 Query: 75 SFDRMQLVRFIVLNLVVLGISVLLMHLLTGRFGIQXXXXXXXXXXXXXXINFFGSRKWVF 134 D ++VRF+++N+ GI+ LL++L G +NF G+R WVF Sbjct: 81 --DGKEIVRFLMINIAASGITFLLLYLFQ-NCGCSLLVSKLAATIGGMMMNFIGNRIWVF 137 >ref|NP_905154.1| GtrA family protein [Porphyromonas gingivalis W83] gb|AAQ66053.1| GtrA family protein [Porphyromonas gingivalis W83] Length = 131 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 41/94 (43%), Positives = 52/94 (55%), Gaps = 8/94 (8%) Query: 10 FIQFLKFNAVGVLNTLIDF-AIFTLLHSLGMMNAPAQIISYSAGTANSFIWNKKVTFRDR 68 F+Q +K+ VGV NTLI IF LL GM + PA +I Y AG NSFIWN+K TFR R Sbjct: 7 FLQLIKYGIVGVSNTLISMIVIFLLLKIAGMKDGPANLIGYIAGLINSFIWNRKWTFRSR 66 Query: 69 DRGSKDSFDRMQLVRFIVLNLVVLGISV-LLMHL 101 R V FI++ ++ + LLM L Sbjct: 67 TSW------RQTFVPFILMFVICYALQYGLLMWL 94 >ref|NP_653901.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847829.1| gtrA family protein [Bacillus anthracis str. Ames] gb|AAP29315.1| gtrA family protein [Bacillus anthracis str. Ames] Length = 127 Score = 62.8 bits (151), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 38/123 (30%), Positives = 58/123 (47%), Gaps = 6/123 (4%) Query: 12 QFLKFNAVGVLNTLIDFAIFTLLHSLGMMNAPAQIISYSAGTANSFIWNKKVTFRDRDRG 71 + LKF VG+ NTLI F +L GM A I+Y G ANS+ WNK F+ ++ Sbjct: 3 KLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLIGVANSYYWNKNWVFKPNNKS 62 Query: 72 SKDSFDRMQLVRFIVLNLVVLGISVLLMHLLTGRFGIQXXXXXXXXXXXXXXINFFGSRK 131 + F +F+ +NL+VLG + L + +L + + INF ++ Sbjct: 63 TSMFF------KFLTVNLIVLGFNTLCLFILVDKLTVNKLIAQIFAIGVGMVINFVLNKI 116 Query: 132 WVF 134 W F Sbjct: 117 WTF 119 >ref|NP_347648.1| Uncharacterized membrane protein, homolog of YNGA/YWCD B.suntilis [Clostridium acetobutylicum] pir||A97025 uncharacterized membrane protein, homolog of YNGA/YWCD B.suntilis [imported] - Clostridium acetobutylicum gb|AAK78988.1| Uncharacterized membrane protein, homolog of YNGA/YWCD B.suntilis [Clostridium acetobutylicum] Length = 151 Score = 62.4 bits (150), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 49/129 (37%), Positives = 72/129 (55%), Gaps = 4/129 (3%) Query: 7 NAGFIQFLKFNAVGVLNTLIDFAIFTLLHSL-GMMNAPAQIISYSAGTANSFIWNKKVTF 65 N F +KF VG LNTL+DF +F++ +SL G+ +QIISYS+GT NS+++NK TF Sbjct: 14 NKKFKHLIKFVCVGCLNTLVDFGMFSIFNSLLGINYIISQIISYSSGTLNSYLFNKFWTF 73 Query: 66 RDRDRGSKDSFDRMQLVRFIVLNLVVLGISVLLMHLLTGRFGIQXXXXXXXXXXXXXXIN 125 D R K + ++++FIV+N LG+S++ + LL +N Sbjct: 74 TD-TRTKKKTIS--EIIQFIVVNAASLGVSLVGLSLLINNSHFNSFFAKIISMVLAQVVN 130 Query: 126 FFGSRKWVF 134 F G R WVF Sbjct: 131 FLGYRFWVF 139 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.332 0.144 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 162,212,914 Number of extensions: 5351906 Number of successful extensions: 17617 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 17623 Number of HSP's successfully gapped: 5 Length of query: 134 Length of database: 757,237,578 Length adjustment: 96 Effective length of query: 38 Effective length of database: 496,588,074 Effective search space: 18870346812 Effective search space used: 18870346812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 120 (50.8 bits)