BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0509.0012.p (134 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_470525.1| similar to transcriptional regulator (MarR fami... 79 4e-14 ref|NP_464750.1| similar to transcriptional regulator (MarR fami... 79 4e-14 ref|NP_830471.1| Transcriptional regulator, MarR family [Bacillu... 78 6e-14 ref|NP_977055.1| transcriptional regulator, MarR family [Bacillu... 78 6e-14 ref|NP_654608.1| HTH_MARR, helix_turn_helix multiple antibiotic ... 77 9e-14 >ref|NP_470525.1| similar to transcriptional regulator (MarR family). [Listeria innocua] pir||AC1581 transcription regulator (MarR family). homolog lin1188 [imported] - Listeria innocua (strain Clip11262) emb|CAC96419.1| lin1188 [Listeria innocua] Length = 150 Score = 78.6 bits (192), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/104 (35%), Positives = 68/104 (65%) Query: 19 LTNDQFLIMRLINSQEPCTSTFLAEAVAVGKSSITAIINRLAEAGFIERTRDENDRRQVY 78 L+ +QF ++R I + + ++T L+ + V KS+IT + +L E G+I R R+++D+R V Sbjct: 38 LSIEQFFVLREIATGDEISATELSACLNVNKSAITPKLKKLEEKGYIRRERNKHDKRAVV 97 Query: 79 LSLTEKGKSTYHAAEKQVQEVISPYFSHFEEQDIEKFITMFEKL 122 L++TEKG S Y EKQ++ +++ + E+D E+F +F+K+ Sbjct: 98 LTITEKGNSVYEECEKQLELLVNEWLEILGEEDSEQFFELFQKI 141 >ref|NP_464750.1| similar to transcriptional regulator (MarR family). [Listeria monocytogenes EGD-e] pir||AI1227 transcription regulator (MarR family). homolog lmo1225 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99303.1| lmo1225 [Listeria monocytogenes] Length = 150 Score = 78.6 bits (192), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/104 (35%), Positives = 68/104 (65%) Query: 19 LTNDQFLIMRLINSQEPCTSTFLAEAVAVGKSSITAIINRLAEAGFIERTRDENDRRQVY 78 L+ +QF ++R I + + ++T LA +AV KS+IT + +L E G+I R R++ D+R V Sbjct: 38 LSIEQFFVLREIATYDGISATELAATLAVNKSAITPKLKKLVEKGYIRRERNQLDKRAVV 97 Query: 79 LSLTEKGKSTYHAAEKQVQEVISPYFSHFEEQDIEKFITMFEKL 122 L+++EKG + Y EKQ++ +++ + E+D E+F +F+K+ Sbjct: 98 LTISEKGNNVYEECEKQLELLVNEWLEILGEKDSEQFFELFQKI 141 >ref|NP_830471.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP07672.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 152 Score = 78.2 bits (191), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 42/107 (39%), Positives = 64/107 (59%) Query: 16 AECLTNDQFLIMRLINSQEPCTSTFLAEAVAVGKSSITAIINRLAEAGFIERTRDENDRR 75 A LT QF I+++++ +T LA+ + V S+IT +I+RL + +ER D++DRR Sbjct: 32 ATGLTPPQFYILKILDHYGASRATTLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRR 91 Query: 76 QVYLSLTEKGKSTYHAAEKQVQEVISPYFSHFEEQDIEKFITMFEKL 122 V + LT+KGK+ A E I+ YFSH E Q+ E + +FEKL Sbjct: 92 VVIIELTKKGKARVEEAMTARNEHIAKYFSHLELQEREDLLRLFEKL 138 >ref|NP_977055.1| transcriptional regulator, MarR family [Bacillus cereus ATCC 10987] gb|AAS39663.1| transcriptional regulator, MarR family [Bacillus cereus ATCC 10987] Length = 152 Score = 77.8 bits (190), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 42/107 (39%), Positives = 64/107 (59%) Query: 16 AECLTNDQFLIMRLINSQEPCTSTFLAEAVAVGKSSITAIINRLAEAGFIERTRDENDRR 75 A LT QF I+++++ +T LA+ + V S+IT +I+RL + +ER D++DRR Sbjct: 32 ATGLTPPQFYILKILDHYGASRATKLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRR 91 Query: 76 QVYLSLTEKGKSTYHAAEKQVQEVISPYFSHFEEQDIEKFITMFEKL 122 V + LT+KGK+ A E I+ YFSH E Q+ E + +FEKL Sbjct: 92 VVVIELTKKGKARVEEAMTARNEHIAKYFSHLELQEREDLLRLFEKL 138 >ref|NP_654608.1| HTH_MARR, helix_turn_helix multiple antibiotic resistance protein [Bacillus anthracis A2012] ref|NP_843191.1| transcriptional regulator, MarR family [Bacillus anthracis str. Ames] gb|AAP24677.1| transcriptional regulator, MarR family [Bacillus anthracis str. Ames] Length = 152 Score = 77.4 bits (189), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 42/107 (39%), Positives = 64/107 (59%) Query: 16 AECLTNDQFLIMRLINSQEPCTSTFLAEAVAVGKSSITAIINRLAEAGFIERTRDENDRR 75 A LT QF I+++++ +T LA+ + V S+IT +I+RL + +ER D++DRR Sbjct: 32 ATGLTPPQFYILKILDHYGASRATKLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRR 91 Query: 76 QVYLSLTEKGKSTYHAAEKQVQEVISPYFSHFEEQDIEKFITMFEKL 122 V + LT+KGK+ A E I+ YFSH E Q+ E + +FEKL Sbjct: 92 VVIIELTKKGKARVEEAMVARNEHIAKYFSHLELQEREDLLRLFEKL 138 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.131 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 167,806,972 Number of extensions: 5474062 Number of successful extensions: 19132 Number of sequences better than 1.0e-05: 118 Number of HSP's gapped: 19179 Number of HSP's successfully gapped: 118 Length of query: 134 Length of database: 757,237,578 Length adjustment: 96 Effective length of query: 38 Effective length of database: 496,588,074 Effective search space: 18870346812 Effective search space used: 18870346812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)