BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0509.0002.p (201 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_832935.1| Transcriptional regulator, MarR family [Bacillu... 96 6e-19 ref|NP_657091.1| MarR, MarR family [Bacillus anthracis A2012] >g... 93 4e-18 dbj|BAB64018.1| probable transcriptional regulator [Streptococcu... 73 3e-12 ref|NP_466349.1| similar to transcriptional regulator (MarR fami... 69 5e-11 ref|ZP_00099548.1| COG1846: Transcriptional regulators [Desulfit... 69 8e-11 >ref|NP_832935.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP10136.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 139 Score = 95.5 bits (236), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 43/132 (32%), Positives = 77/132 (58%) Query: 61 QEFLGFLLGSTHRRISNAFARVLKPYDITPEQWSILLMICDREGINQKEVXXXXXKDQPT 120 + +G+L+ T +++N F + LKPY +TPEQW I+ ++C + QKE+ KDQ T Sbjct: 4 HDLIGYLVHRTDVKMTNYFTKKLKPYGVTPEQWGIISVLCSQRSTTQKELAEAIDKDQTT 63 Query: 121 TARIVELLQKKGFIHKTMSPTDRRAFQLYATETGKSLIKRTVSLEQQTIAAAVNGLRPEQ 180 R+++ +++KG + K ++ DRR+ L+ TE G L K + + + + L E+ Sbjct: 64 VVRMIQSMERKGIVKKALNDQDRRSHNLFLTEKGDELKKTILPVVKDAHHFVTSNLSEEE 123 Query: 181 IEDLRSMLELIY 192 I+ L+S+L +Y Sbjct: 124 IKVLQSLLNKLY 135 >ref|NP_657091.1| MarR, MarR family [Bacillus anthracis A2012] ref|NP_845527.1| transcriptional regulator, MarR family [Bacillus anthracis str. Ames] gb|AAP27013.1| transcriptional regulator, MarR family [Bacillus anthracis str. Ames] Length = 139 Score = 92.8 bits (229), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 42/132 (31%), Positives = 76/132 (57%) Query: 61 QEFLGFLLGSTHRRISNAFARVLKPYDITPEQWSILLMICDREGINQKEVXXXXXKDQPT 120 + +G+L+ T +++N F + LKP+ +TPEQW I+ ++C + QKE+ KDQ T Sbjct: 4 HDLIGYLVHRTDVKMTNYFTKKLKPFGVTPEQWGIISVLCSQRATTQKELAEAIDKDQTT 63 Query: 121 TARIVELLQKKGFIHKTMSPTDRRAFQLYATETGKSLIKRTVSLEQQTIAAAVNGLRPEQ 180 R+++ +++KG + K ++ DRR+ L+ TE G L K + + + L E+ Sbjct: 64 VVRMIQSMERKGIVKKALNEQDRRSHNLFLTEKGDELKKTILPVVTDAHHFVTSNLSEEE 123 Query: 181 IEDLRSMLELIY 192 I+ L+S+L +Y Sbjct: 124 IKVLQSLLNKLY 135 >dbj|BAB64018.1| probable transcriptional regulator [Streptococcus criceti] Length = 142 Score = 73.2 bits (178), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 40/133 (30%), Positives = 69/133 (51%) Query: 62 EFLGFLLGSTHRRISNAFARVLKPYDITPEQWSILLMICDREGINQKEVXXXXXKDQPTT 121 E LGFLL + R I + LK Y +T QW++L ++ + I+Q E+ D+ Sbjct: 5 ESLGFLLNYSARLIKRRLDQELKQYHLTTSQWAVLKILSEHSHISQAELADLTGTDRANC 64 Query: 122 ARIVELLQKKGFIHKTMSPTDRRAFQLYATETGKSLIKRTVSLEQQTIAAAVNGLRPEQI 181 +++ L K F+ KT+SP DRR++ + T + L++ V+L QT A+ G ++ Sbjct: 65 GAVLDKLIAKQFVEKTLSPQDRRSYVVSITPSALELVENIVALVNQTNRQALEGFSKDEQ 124 Query: 182 EDLRSMLELIYHN 194 + + L L+ N Sbjct: 125 QQFVNSLNLVIKN 137 >ref|NP_466349.1| similar to transcriptional regulator (MarR family) [Listeria monocytogenes EGD-e] pir||AB1428 transcription regulator (MarR family) homolog lmo2827 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD01040.1| lmo2827 [Listeria monocytogenes] Length = 140 Score = 69.3 bits (168), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 53/92 (57%) Query: 64 LGFLLGSTHRRISNAFARVLKPYDITPEQWSILLMICDREGINQKEVXXXXXKDQPTTAR 123 + F + +T +++ R + YD+TPEQWS+L I E I+QKE+ KD PT R Sbjct: 8 ISFDVNTTAKKMHLFLLRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNR 67 Query: 124 IVELLQKKGFIHKTMSPTDRRAFQLYATETGK 155 IV++L +K I + +S DRR L TE G+ Sbjct: 68 IVDVLLRKELIVREISTEDRRISLLSLTEKGR 99 >ref|ZP_00099548.1| COG1846: Transcriptional regulators [Desulfitobacterium hafniense] Length = 151 Score = 68.6 bits (166), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 6/144 (4%) Query: 57 LTSPQEF----LGFLLGSTHRRISNAFARVLKPYDI--TPEQWSILLMICDREGINQKEV 110 +TS E+ LG L + R I++ R + DI EQW ILL + +G Q + Sbjct: 6 MTSFYEYTSGSLGHKLNKSARLITHKLVRNFRESDIKINAEQWKILLYLYQEDGQTQTSL 65 Query: 111 XXXXXKDQPTTARIVELLQKKGFIHKTMSPTDRRAFQLYATETGKSLIKRTVSLEQQTIA 170 KD+P+ +RIV ++K + +T P+DRR ++ TE G+ + + +S+ ++T Sbjct: 66 AESTGKDEPSVSRIVNTMEKFNLVFRTRHPSDRRTNLIFLTENGRDMRETLMSMGKKTNR 125 Query: 171 AAVNGLRPEQIEDLRSMLELIYHN 194 G+ ++IE +L+ + N Sbjct: 126 EVTEGIALQEIETCIRVLDKVIEN 149 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 239,944,391 Number of extensions: 7562424 Number of successful extensions: 17197 Number of sequences better than 1.0e-05: 91 Number of HSP's gapped: 17249 Number of HSP's successfully gapped: 91 Length of query: 201 Length of database: 757,237,578 Length adjustment: 120 Effective length of query: 81 Effective length of database: 431,425,698 Effective search space: 34945481538 Effective search space used: 34945481538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 123 (52.0 bits)