BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0505.0010.p (216 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_832098.1| Catabolite gene activator [Bacillus cereus ATCC... 107 2e-22 ref|NP_979761.1| cyclic nucleotide-binding domain protein [Bacil... 98 1e-19 ref|NP_845790.1| cyclic nucleotide-binding domain protein [Bacil... 98 1e-19 ref|NP_657369.1| cNMP_binding, Cyclic nucleotide-binding domain ... 98 1e-19 ref|NP_561263.1| probable transcriptional regulator [Clostridium... 97 2e-19 >ref|NP_832098.1| Catabolite gene activator [Bacillus cereus ATCC 14579] gb|AAP09299.1| Catabolite gene activator [Bacillus cereus ATCC 14579] Length = 233 Score = 107 bits (267), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 45/146 (30%), Positives = 91/146 (62%) Query: 22 NGMMEIFSSGAISGMELRRYSDGEAICSVGDRLEHMFILVEGRLKIHTLLPNGKSLLVRF 81 N +E+FS + +L + GE IC++ D ++ ++ +V+G++K++T+ P GK L++RF Sbjct: 17 NKTLEVFSEIDTAYFQLNHFEKGELICNIDDEMDRLYFVVKGKVKVYTITPEGKKLILRF 76 Query: 82 ARPMSVIGDVELLRQYPVKNEVVSMGESLLLAAGRALVLKEFEENTALLRFLVGELSHKM 141 P++++GD+EL++ N V + + + ++ ++ + + ++FL+ +++ + Sbjct: 77 INPLAIVGDIELIQNSKAHNVVEACSDVVAISISNTVIRNKLLHDPIFMKFLLENIANTL 136 Query: 142 YTLGQTTALNLLYPLENRFASYLLSL 167 + TALNLLYP+E R ASYLLS+ Sbjct: 137 KISTRFTALNLLYPVEVRVASYLLSI 162 >ref|NP_979761.1| cyclic nucleotide-binding domain protein [Bacillus cereus ATCC 10987] gb|AAS42369.1| cyclic nucleotide-binding domain protein [Bacillus cereus ATCC 10987] Length = 230 Score = 98.2 bits (243), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 52/161 (32%), Positives = 83/161 (51%) Query: 6 MQWIADQDKIRMLAGHNGMMEIFSSGAISGMELRRYSDGEAICSVGDRLEHMFILVEGRL 65 M+ I + K+ N + FS+ MEL + E IC + ++++F VEG+ Sbjct: 1 MKKICNSIKLAEYMKQNNIDSFFSNDMKPYMELIFFKKNEFICRENEEIDYLFFFVEGKA 60 Query: 66 KIHTLLPNGKSLLVRFARPMSVIGDVELLRQYPVKNEVVSMGESLLLAAGRALVLKEFEE 125 K L NGKS+L+ F + ++GDV L+ + V M +S + V + Sbjct: 61 KAFNTLSNGKSVLLCFXDSLQLLGDVSLIHSQKTASNVQVMADSYCVGLPLGKVRNQLFH 120 Query: 126 NTALLRFLVGELSHKMYTLGQTTALNLLYPLENRFASYLLS 166 + LR + G L+HK+ L + + +NLLYPLENR ASY+L+ Sbjct: 121 DAKFLRCICGSLAHKLNRLSKNSTINLLYPLENRLASYMLA 161 >ref|NP_845790.1| cyclic nucleotide-binding domain protein [Bacillus anthracis str. Ames] gb|AAP27276.1| cyclic nucleotide-binding domain protein [Bacillus anthracis str. Ames] Length = 230 Score = 97.8 bits (242), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 51/161 (31%), Positives = 84/161 (52%) Query: 6 MQWIADQDKIRMLAGHNGMMEIFSSGAISGMELRRYSDGEAICSVGDRLEHMFILVEGRL 65 M+ + + K+ N + FS+ MEL + E IC + +++++ VEG+ Sbjct: 1 MKKVCNSIKLAEYMKQNNIDSFFSNDMNPYMELIFFKKNEFICRENEEIDYLYFFVEGKA 60 Query: 66 KIHTLLPNGKSLLVRFARPMSVIGDVELLRQYPVKNEVVSMGESLLLAAGRALVLKEFEE 125 K L NGKS+L+ F + ++GDVEL+ + V M +S + V + Sbjct: 61 KAFNTLSNGKSVLLCFYDSLQLLGDVELIHSQKTASNVQVMADSYCVGLPLGKVRNQLFH 120 Query: 126 NTALLRFLVGELSHKMYTLGQTTALNLLYPLENRFASYLLS 166 + LR + G L+HK+ L + + +NLLYPLENR ASY+L+ Sbjct: 121 DAKFLRCICGSLAHKLNRLSKNSTINLLYPLENRLASYMLA 161 >ref|NP_657369.1| cNMP_binding, Cyclic nucleotide-binding domain [Bacillus anthracis A2012] Length = 230 Score = 97.8 bits (242), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 51/161 (31%), Positives = 84/161 (52%) Query: 6 MQWIADQDKIRMLAGHNGMMEIFSSGAISGMELRRYSDGEAICSVGDRLEHMFILVEGRL 65 M+ + + K+ N + FS+ MEL + E IC + +++++ VEG+ Sbjct: 1 MKKVCNSIKLAEYMKQNNIDSFFSNDMNPYMELIFFKKNEFICRENEEIDYLYFFVEGKA 60 Query: 66 KIHTLLPNGKSLLVRFARPMSVIGDVELLRQYPVKNEVVSMGESLLLAAGRALVLKEFEE 125 K L NGKS+L+ F + ++GDVEL+ + V M +S + V + Sbjct: 61 KAFNTLSNGKSVLLCFYDSLQLLGDVELIHSQKTASNVQVMADSYCVGLPLGKVRNQLFH 120 Query: 126 NTALLRFLVGELSHKMYTLGQTTALNLLYPLENRFASYLLS 166 + LR + G L+HK+ L + + +NLLYPLENR ASY+L+ Sbjct: 121 DAKFLRCICGSLAHKLNRLSKNSTINLLYPLENRLASYMLA 161 >ref|NP_561263.1| probable transcriptional regulator [Clostridium perfringens] dbj|BAB80053.1| probable transcriptional regulator [Clostridium perfringens str. 13] Length = 223 Score = 97.1 bits (240), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 51/166 (30%), Positives = 92/166 (55%), Gaps = 8/166 (4%) Query: 6 MQWIADQDKIRMLAGHNGMMEIFSSGAISGMELRRYSDGEAICSVGDRLEHMFILVEGRL 65 M + +++K+ + + IFS + +EL + E IC + + L +++ V G+ Sbjct: 1 MLLVKNEEKLLEVINKYELNSIFSQEIMPFLELHMFKKNEHICFMNEELNYLYFFVHGKA 60 Query: 66 KIHTLLPNGKSLLVRFARPMSVIGDVELLRQYPVKNEVVSMGESLLLA----AGRALVLK 121 K++ LPNGKSLL+ F P+ +IGD+EL+ + V ++ SL +A A ++ LK Sbjct: 61 KVYKTLPNGKSLLLEFYEPVQLIGDLELISKIKANCNVKALKSSLCIAIHIQAVNSIALK 120 Query: 122 EFEENTALLRFLVGELSHKMYTLGQTTALNLLYPLENRFASYLLSL 167 + L ++ LS+K+ T+++ + YPLEN+ ASYLL++ Sbjct: 121 DLN----FLMYITKNLSNKLAQCSVTSSITITYPLENKLASYLLAM 162 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 287,903,708 Number of extensions: 10217899 Number of successful extensions: 25607 Number of sequences better than 1.0e-05: 17 Number of HSP's gapped: 25618 Number of HSP's successfully gapped: 17 Length of query: 216 Length of database: 757,237,578 Length adjustment: 121 Effective length of query: 95 Effective length of database: 428,710,599 Effective search space: 40727506905 Effective search space used: 40727506905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 123 (52.0 bits)