BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0504.0058.p (150 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243237.1| BH2371~unknown conserved protein in B. subtilis... 105 4e-22 ref|NP_833494.1| IG hypothetical 16757 [Bacillus cereus ATCC 145... 96 3e-19 ref|NP_657737.1| hypothetical protein predicted by GeneMark [Bac... 93 2e-18 ref|NP_692550.1| hypothetical protein OB1629 [Oceanobacillus ihe... 92 3e-18 ref|NP_389584.1| similar to hypothetical proteins [Bacillus subt... 86 3e-16 >ref|NP_243237.1| BH2371~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||C83946 hypothetical protein BH2371 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06090.1| BH2371~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 146 Score = 105 bits (261), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 58/125 (46%), Positives = 83/125 (66%) Query: 23 VREDIMGKAKELASLISTSEEVKHFQQAEQKIQNHERVQSLIAAIKKKQKEIVAFESFKN 82 R+DI +A+ELA +I+ +EEV F++AE++I H RVQ +IA IKK QKE V + + Sbjct: 6 TRDDIKQRARELALMIAETEEVDFFKRAEKQINEHLRVQEIIAEIKKYQKEAVNLQHYGK 65 Query: 83 KEMVAKIEREIEVLQDEIDEIPVVNEFQQSQSDINYLLQLVISVIRDTVSEKINVEAGTE 142 KE + ++E +I+ LQ+EID IP+V EF+QSQ D+N LLQLV I TV++ I G + Sbjct: 66 KEALKEVEAKIDELQNEIDAIPLVQEFKQSQMDVNELLQLVSMTISKTVTDHIITSMGGD 125 Query: 143 APPST 147 T Sbjct: 126 LLRGT 130 >ref|NP_833494.1| IG hypothetical 16757 [Bacillus cereus ATCC 14579] gb|AAP10695.1| IG hypothetical 16757 [Bacillus cereus ATCC 14579] Length = 143 Score = 95.5 bits (236), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 81/126 (64%) Query: 24 REDIMGKAKELASLISTSEEVKHFQQAEQKIQNHERVQSLIAAIKKKQKEIVAFESFKNK 83 ++DI+ +AKELA +IS +EEV F++AE +I +E V+ I IK QK+ V + + Sbjct: 6 KDDIVEQAKELAKMISETEEVDFFKKAEAQIHKNENVKRAIDEIKALQKQAVNLQHYGKW 65 Query: 84 EMVAKIEREIEVLQDEIDEIPVVNEFQQSQSDINYLLQLVISVIRDTVSEKINVEAGTEA 143 E + K+E EI+ LQD++D IPVV +F+ SQ+ +N LLQLV S I + V+++I + G + Sbjct: 66 EALKKVEAEIDALQDKLDSIPVVQQFKSSQTYVNDLLQLVASTISNNVTDEILISTGGDV 125 Query: 144 PPSTCG 149 G Sbjct: 126 LKGETG 131 >ref|NP_657737.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_846154.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_980102.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP27640.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS42710.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 143 Score = 93.2 bits (230), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 54/137 (39%), Positives = 83/137 (60%), Gaps = 11/137 (8%) Query: 24 REDIMGKAKELASLISTSEEVKHFQQAEQKIQNHERVQSLIAAIKKKQKEIVAFESFKNK 83 +++I+ +AKELA +IS +EEV F++AE +I +E V+ I IK QK+ V + + Sbjct: 6 KDEIVEQAKELAKMISETEEVDFFKKAEAQIHKNENVKRAIDEIKALQKQAVNLQHYGKW 65 Query: 84 EMVAKIEREIEVLQDEIDEIPVVNEFQQSQSDINYLLQLVISVIRDTVSEKINVE----- 138 E + K+E EI+ LQD++D IPVV EF+ SQ+ +N LLQLV S I + V+++I + Sbjct: 66 EALKKVEAEIDALQDKLDSIPVVQEFKSSQTYVNDLLQLVASTISNNVTDEILISTNGDV 125 Query: 139 ------AGTEAPPSTCG 149 A E+ CG Sbjct: 126 LKGETGAAVESKKGNCG 142 >ref|NP_692550.1| hypothetical protein OB1629 [Oceanobacillus iheyensis HTE831] dbj|BAC13585.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 142 Score = 92.0 bits (227), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 51/127 (40%), Positives = 86/127 (67%), Gaps = 8/127 (6%) Query: 24 REDIMGKAKELASLISTSEEVKHFQQAEQKIQNHERVQSLIAAIKKKQKEIVAFESFKNK 83 R++++ +AK+LA++++++EE+ F+Q E K+ +++VQSLI IK QK+ V F++++ + Sbjct: 6 RKEVLDEAKKLANMLASTEEIDRFKQVEAKLNENKKVQSLIQKIKTLQKQAVNFQAYEKR 65 Query: 84 EMVAKIEREIEVLQDEIDEIPVVNEFQQSQSDINYLLQLVISVIRDTVSEKINVEAGTEA 143 E + ++E EI+ LQ EID+IPVV EF+++Q +N +LQL VS+ I E E Sbjct: 66 EALKRVEEEIDRLQAEIDDIPVVQEFKETQIVVNDVLQL--------VSKTIAREVTNEV 117 Query: 144 PPSTCGD 150 ST GD Sbjct: 118 IESTGGD 124 >ref|NP_389584.1| similar to hypothetical proteins [Bacillus subtilis] pir||C69884 conserved hypothetical protein ymcA - Bacillus subtilis emb|CAB13575.1| ymcA [Bacillus subtilis subsp. subtilis str. 168] Length = 143 Score = 85.9 bits (211), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 46/129 (35%), Positives = 82/129 (63%) Query: 21 LIVREDIMGKAKELASLISTSEEVKHFQQAEQKIQNHERVQSLIAAIKKKQKEIVAFESF 80 L ++DI+ +A+ LA +IS +EEV F++AE +I +++V +++ IK QK+ V + + Sbjct: 3 LYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHY 62 Query: 81 KNKEMVAKIEREIEVLQDEIDEIPVVNEFQQSQSDINYLLQLVISVIRDTVSEKINVEAG 140 + E + ++E +I+ LQ+E++EIPV+ EF+ SQ ++N LLQLV I + V+ +I G Sbjct: 63 EKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTG 122 Query: 141 TEAPPSTCG 149 + G Sbjct: 123 GDLLKGETG 131 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.311 0.128 0.331 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 186,320,474 Number of extensions: 6317576 Number of successful extensions: 30330 Number of sequences better than 1.0e-05: 11 Number of HSP's gapped: 30342 Number of HSP's successfully gapped: 11 Length of query: 150 Length of database: 757,237,578 Length adjustment: 109 Effective length of query: 41 Effective length of database: 461,291,787 Effective search space: 18912963267 Effective search space used: 18912963267 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)