BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0504.0048.p (57 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_416284.1| putative DEOR-type transcriptional regulator [E... 61 8e-09 ref|NP_288206.1| putative DEOR-type transcriptional regulator [E... 61 8e-09 ref|NP_707343.1| putative DEOR-type transcriptional regulator [S... 61 8e-09 ref|NP_106477.1| transcription regulator [Mesorhizobium loti MAF... 58 7e-08 ref|ZP_00183278.1| hypothetical protein Exigu133601 [Exiguobacte... 56 2e-07 >ref|NP_416284.1| putative DEOR-type transcriptional regulator [Escherichia coli K12] sp|P77721|YDJF_ECOLI Putative HTH-type transcriptional regulator ydjF pir||B64937 hypothetical protein b1770 - Escherichia coli (strain K-12) dbj|BAA15561.1| L-fucose operon activator. [Escherichia coli] dbj|BAA15568.1| L-fucose operon activator. [Escherichia coli] gb|AAC74840.1| putative DEOR-type transcriptional regulator [Escherichia coli K12] Length = 252 Score = 61.2 bits (147), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 39/57 (68%) Query: 1 MLRQAQKVVLLADHTKFDKTAFTRLVELSSIDVLITDRRPAESWLTRLAEENIEVLY 57 M+RQA +V LL DH+KFD+ AF +L + S I+ +ITD+ P W+ + NI++++ Sbjct: 196 MIRQATEVALLVDHSKFDRKAFVQLADFSHINYIITDKSPGAEWIAFCKDNNIQLVW 252 >ref|NP_288206.1| putative DEOR-type transcriptional regulator [Escherichia coli O157:H7 EDL933] ref|NP_310506.1| putative DEOR-type transcriptional regulator [Escherichia coli O157:H7] ref|NP_754068.1| Hypothetical transcriptional regulator ydjF [Escherichia coli CFT073] pir||G90938 probable DEOR-type transcription regulator [imported] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) pir||C85787 probable DEOR-type transcription regulator Z2808 [imported] - Escherichia coli (strain O157:H7, substrain EDL933) gb|AAG56759.1| putative DEOR-type transcriptional regulator [Escherichia coli O157:H7 EDL933] dbj|BAB35902.1| putative DEOR-type transcriptional regulator [Escherichia coli O157:H7] gb|AAN80633.1| Hypothetical transcriptional regulator ydjF [Escherichia coli CFT073] Length = 252 Score = 61.2 bits (147), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 39/57 (68%) Query: 1 MLRQAQKVVLLADHTKFDKTAFTRLVELSSIDVLITDRRPAESWLTRLAEENIEVLY 57 M+RQA +V LL DH+KFD+ AF +L + S I+ +ITD+ P W+ + NI++++ Sbjct: 196 MIRQATEVALLVDHSKFDRKAFVQLADFSHINYIITDKSPGAEWIAFCKDNNIQLVW 252 >ref|NP_707343.1| putative DEOR-type transcriptional regulator [Shigella flexneri 2a str. 301] ref|NP_837138.1| putative DEOR-type transcriptional regulator [Shigella flexneri 2a str. 2457T] gb|AAN43050.1| putative DEOR-type transcriptional regulator [Shigella flexneri 2a str. 301] gb|AAP16945.1| putative DEOR-type transcriptional regulator [Shigella flexneri 2a str. 2457T] Length = 252 Score = 60.8 bits (146), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 39/57 (68%) Query: 1 MLRQAQKVVLLADHTKFDKTAFTRLVELSSIDVLITDRRPAESWLTRLAEENIEVLY 57 M+RQA +V LL DH+KFD+ AF +L + S I+ +ITD+ P W+ + NI++++ Sbjct: 196 MIRQATEVALLVDHSKFDRKAFVQLADFSHINYIITDKSPGAEWIAFCKDNNIQLVW 252 >ref|NP_106477.1| transcription regulator [Mesorhizobium loti MAFF303099] dbj|BAB52263.1| transcription regulator [Mesorhizobium loti] Length = 263 Score = 57.8 bits (138), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 39/57 (68%) Query: 1 MLRQAQKVVLLADHTKFDKTAFTRLVELSSIDVLITDRRPAESWLTRLAEENIEVLY 57 + QA+K+V+LADH+KF +A R++ S+I +ITDRRPA L ++ +EVLY Sbjct: 195 LCEQARKIVILADHSKFGLSARYRILPHSAITAIITDRRPASDMLDKIEAAGVEVLY 251 >ref|ZP_00183278.1| hypothetical protein Exigu133601 [Exiguobacterium sp. 255-15] Length = 251 Score = 56.2 bits (134), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/53 (47%), Positives = 36/53 (67%) Query: 1 MLRQAQKVVLLADHTKFDKTAFTRLVELSSIDVLITDRRPAESWLTRLAEENI 53 M+R + +V++LADHTKF+K ++ +L ID+LITD RP E W L E +I Sbjct: 191 MIRSSAEVIVLADHTKFEKRFLHKVCDLDQIDILITDERPTEQWQKWLQEADI 243 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 66,058,754 Number of extensions: 1485987 Number of successful extensions: 3960 Number of sequences better than 1.0e-05: 9 Number of HSP's gapped: 3963 Number of HSP's successfully gapped: 9 Length of query: 57 Length of database: 757,237,578 Length adjustment: 29 Effective length of query: 28 Effective length of database: 678,499,707 Effective search space: 18997991796 Effective search space used: 18997991796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 120 (50.8 bits)