BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0504.0032.p (104 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_470520.1| similar to unknown protein [Listeria innocua] >... 100 7e-21 ref|NP_347485.1| Predicted transcriptional regulator [Clostridiu... 99 4e-20 ref|ZP_00182839.1| hypothetical protein Exigu182401 [Exiguobacte... 96 2e-19 ref|NP_391248.1| similar to hypothetical proteins [Bacillus subt... 96 4e-19 gb|AAB91592.1| Orf1 [Bacillus subtilis] 95 5e-19 >ref|NP_470520.1| similar to unknown protein [Listeria innocua] ref|NP_464745.1| similar to unknown protein [Listeria monocytogenes EGD-e] pir||AD1227 hypothetical protein lmo1220 [imported] - Listeria monocytogenes (strain EGD-e) pir||AF1580 hypothetical protein homolog lin1183 [imported] - Listeria innocua (strain Clip11262) emb|CAC99298.1| lmo1220 [Listeria monocytogenes] emb|CAC96414.1| lin1183 [Listeria innocua] Length = 107 Score = 100 bits (250), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 48/101 (47%), Positives = 65/101 (64%) Query: 4 DVKSLLAGAEHVHQIIGKKWVSLIIHVLNDGPKRFSELNTMIPDLSKRMLNERLKELEEY 63 D ++ E Q++GK+W LII+VL GPKRF ++ IP +S R+L ERLKELEE Sbjct: 3 DAHTVCPKFESAFQLLGKRWTGLIINVLLTGPKRFKQVAAEIPQMSDRVLAERLKELEEM 62 Query: 64 GLLIRVVIPDRPVRTEYSLTAKGQELGEALGHVEAWALKWL 104 + +R V P+ PVR EY LT KG+ L E + V+ WA KW+ Sbjct: 63 DICLRQVYPETPVRIEYELTEKGKALQEVMLEVQCWADKWV 103 >ref|NP_347485.1| Predicted transcriptional regulator [Clostridium acetobutylicum] pir||F97004 probable transcription regulator [imported] - Clostridium acetobutylicum gb|AAK78825.1| Predicted transcriptional regulator [Clostridium acetobutylicum] Length = 102 Score = 98.6 bits (244), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 46/100 (46%), Positives = 64/100 (64%) Query: 4 DVKSLLAGAEHVHQIIGKKWVSLIIHVLNDGPKRFSELNTMIPDLSKRMLNERLKELEEY 63 D L E +++GK+W LIIH L G KRFS++ +IP+LS RML ER +ELE+ Sbjct: 2 DTFKLCPHFEAAFELLGKRWTGLIIHSLLKGAKRFSDIQDIIPNLSARMLTERFRELEKQ 61 Query: 64 GLLIRVVIPDRPVRTEYSLTAKGQELGEALGHVEAWALKW 103 G+++R V + PVR EY LT KG+EL + ++ WA KW Sbjct: 62 GIVVRKVYAETPVRIEYELTEKGRELESVMQEIQKWAEKW 101 >ref|ZP_00182839.1| hypothetical protein Exigu182401 [Exiguobacterium sp. 255-15] Length = 108 Score = 95.9 bits (237), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 45/94 (47%), Positives = 63/94 (67%) Query: 7 SLLAGAEHVHQIIGKKWVSLIIHVLNDGPKRFSELNTMIPDLSKRMLNERLKELEEYGLL 66 +L EH +I+GKKW LI+ L RF+E+ IP+LS RML ER+KELE G++ Sbjct: 11 ALCPKVEHAFEILGKKWTGLILRHLMTKTCRFNEIQDAIPELSGRMLTERMKELEAEGIV 70 Query: 67 IRVVIPDRPVRTEYSLTAKGQELGEALGHVEAWA 100 IR VIP+RP++ +YSLT KG++L + +E WA Sbjct: 71 IRTVIPERPIKIQYSLTDKGRQLEPVIRSIEEWA 104 >ref|NP_391248.1| similar to hypothetical proteins [Bacillus subtilis] pir||E70028 conserved hypothetical protein yvaP - Bacillus subtilis emb|CAB15373.1| yvaP [Bacillus subtilis subsp. subtilis str. 168] Length = 236 Score = 95.5 bits (236), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 46/92 (50%), Positives = 64/92 (69%) Query: 13 EHVHQIIGKKWVSLIIHVLNDGPKRFSELNTMIPDLSKRMLNERLKELEEYGLLIRVVIP 72 E I+ K+WV+LI+ L +G +RFSE+ +P+LS R+L+ERLKELE G++ R VIP Sbjct: 94 EKAVDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELELEGVVKRDVIP 153 Query: 73 DRPVRTEYSLTAKGQELGEALGHVEAWALKWL 104 + PVR EYSLT KG+ L LG + WA +W+ Sbjct: 154 ETPVRIEYSLTDKGKALAPILGEISKWATEWI 185 >gb|AAB91592.1| Orf1 [Bacillus subtilis] Length = 108 Score = 94.7 bits (234), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 46/92 (50%), Positives = 63/92 (68%) Query: 13 EHVHQIIGKKWVSLIIHVLNDGPKRFSELNTMIPDLSKRMLNERLKELEEYGLLIRVVIP 72 E I+ K+WV+LI+ L +G +RFSE+ +P+LS R+L+ERLKELE G++ R VIP Sbjct: 11 EKAVDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELELEGVVKRDVIP 70 Query: 73 DRPVRTEYSLTAKGQELGEALGHVEAWALKWL 104 + PVR EYSLT KG+ L LG + WA W+ Sbjct: 71 ETPVRIEYSLTDKGKALAPILGEISKWATDWI 102 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 155,255,061 Number of extensions: 5438906 Number of successful extensions: 15862 Number of sequences better than 1.0e-05: 256 Number of HSP's gapped: 15861 Number of HSP's successfully gapped: 256 Length of query: 104 Length of database: 757,237,578 Length adjustment: 71 Effective length of query: 33 Effective length of database: 564,465,549 Effective search space: 18627363117 Effective search space used: 18627363117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)