BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0504.0027.p (121 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00097596.1| hypothetical protein [Desulfitobacterium hafn... 97 1e-19 ref|NP_694230.1| hypothetical protein OB3308 [Oceanobacillus ihe... 70 2e-11 ref|NP_845073.1| conserved hypothetical protein [Bacillus anthra... 64 1e-09 ref|NP_901221.1| hypothetical protein CV1551 [Chromobacterium vi... 62 4e-09 ref|NP_832481.1| hypothetical Cytosolic Protein [Bacillus cereus... 61 8e-09 >ref|ZP_00097596.1| hypothetical protein [Desulfitobacterium hafniense] Length = 135 Score = 97.1 bits (240), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 47/112 (41%), Positives = 70/112 (62%) Query: 9 QKEGQAYVLCRPDDQPLRTEQDVLDLISGCFEHNSYKLLLQEGTLSDEFYNLRTGLAGTT 68 + E + Y+ + L TE D LDLIS C+EH +L+L TLS++F++L+TG+AG Sbjct: 23 ETENKKYIELISIENRLNTENDTLDLISLCWEHELSRLMLHYTTLSEDFFDLKTGVAGGI 82 Query: 69 LQKLINYHVKAAAVIHTEEATQGRFKELLTELNKGEDFRVFGSETEALDWLL 120 +QK NY +K ++ E +GRF+E+ E NKG FR++ S+ EA WLL Sbjct: 83 IQKFSNYGIKIVLIVPQETMQKGRFREMTAETNKGNHFRMYESKEEAEAWLL 134 >ref|NP_694230.1| hypothetical protein OB3308 [Oceanobacillus iheyensis HTE831] dbj|BAC15264.1| hypothetical protein [Oceanobacillus iheyensis HTE831] Length = 122 Score = 69.7 bits (169), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/118 (33%), Positives = 60/118 (50%), Gaps = 1/118 (0%) Query: 3 MKIESIQKEGQAYVLCRPDDQPLRTEQDVLD-LISGCFEHNSYKLLLQEGTLSDEFYNLR 61 M I+ + GQ + D L EQ LD +++ E S ++ L + +S++F+NLR Sbjct: 1 MNIKKTEVNGQIIAIVHSDSILLTNEQSALDTMMTISHETESNRITLNKEAISEDFFNLR 60 Query: 62 TGLAGTTLQKLINYHVKAAAVIHTEEATQGRFKELLTELNKGEDFRVFGSETEALDWL 119 T +AG LQK INY++K A + T + + E NKG SE EA+D L Sbjct: 61 TRIAGDILQKFINYNIKFAIIGDFSSYTSKSLNDFMYECNKGNHIFFVSSEQEAIDKL 118 >ref|NP_845073.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP26559.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 122 Score = 63.5 bits (153), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 36/118 (30%), Positives = 64/118 (54%), Gaps = 1/118 (0%) Query: 3 MKIESIQKEGQAYVLCRPDDQPLRTEQDVLDLISGC-FEHNSYKLLLQEGTLSDEFYNLR 61 M+I+ + +G + R + + Q LD ++ +E N+ +++ + +S++F++L+ Sbjct: 1 MEIKKVVIDGINIAVIRNNKVLISDVQSALDTMATVQYEVNAKHIIIHKSLISEDFFDLK 60 Query: 62 TGLAGTTLQKLINYHVKAAAVIHTEEATQGRFKELLTELNKGEDFRVFGSETEALDWL 119 T LAG LQK INY VK A V T K+ + E NKG+D +E +A++ L Sbjct: 61 TRLAGDILQKFINYKVKFAIVGDFSMYTSKSLKDFIYECNKGKDIFYLATEQQAIEKL 118 >ref|NP_901221.1| hypothetical protein CV1551 [Chromobacterium violaceum ATCC 12472] gb|AAQ59227.1| hypothetical protein CV1551 [Chromobacterium violaceum ATCC 12472] Length = 117 Score = 62.0 bits (149), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 32/87 (36%), Positives = 45/87 (51%) Query: 33 DLISGCFEHNSYKLLLQEGTLSDEFYNLRTGLAGTTLQKLINYHVKAAAVIHTEEATQGR 92 +LIS C +LL+ L + F+ L + AG LQKL NY ++ A VI + R Sbjct: 28 ELISACIGEECARLLIPREALPEAFFQLSSRFAGEFLQKLQNYRLQTAVVIDAQRGYGQR 87 Query: 93 FKELLTELNKGEDFRVFGSETEALDWL 119 F E L E +G R+F +A+DWL Sbjct: 88 FGEFLREAKRGHYTRLFLERDKAMDWL 114 >ref|NP_832481.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] gb|AAP09682.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] Length = 122 Score = 60.8 bits (146), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 36/118 (30%), Positives = 62/118 (52%), Gaps = 1/118 (0%) Query: 3 MKIESIQKEGQAYVLCRPDDQPLRTEQDVLDLISGC-FEHNSYKLLLQEGTLSDEFYNLR 61 M+I+ + +G + R D + Q LD ++ E ++ +++ + +S++F++L+ Sbjct: 1 MEIKKVVIDGINIAVIRNDKVLISDVQSALDTMATVQNEVDAKHIIIHKSLISEDFFDLK 60 Query: 62 TGLAGTTLQKLINYHVKAAAVIHTEEATQGRFKELLTELNKGEDFRVFGSETEALDWL 119 T LAG LQK INY VK A V T K+ + E NKG D +E +A++ L Sbjct: 61 TRLAGDILQKFINYKVKIAIVGDFSMYTSKSLKDFIYECNKGNDIFYLATEQQAIEKL 118 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 171,217,731 Number of extensions: 6160018 Number of successful extensions: 14625 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 14625 Number of HSP's successfully gapped: 7 Length of query: 121 Length of database: 757,237,578 Length adjustment: 85 Effective length of query: 36 Effective length of database: 526,454,163 Effective search space: 18952349868 Effective search space used: 18952349868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)