BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0504.0015.p (288 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_563003.1| two-component response regulator [Clostridium p... 115 8e-25 ref|NP_242975.1| BH2109~unknown conserved protein [Bacillus halo... 111 2e-23 ref|NP_782430.1| transcriptional regulatory protein [Clostridium... 103 4e-21 ref|NP_645013.1| ORFID:MW0198~hypothetical protein, similar to t... 103 6e-21 ref|NP_241659.1| two-component sensor response regulator [Bacill... 102 9e-21 >ref|NP_563003.1| two-component response regulator [Clostridium perfringens] dbj|BAB81793.1| two-component response regulator [Clostridium perfringens str. 13] Length = 507 Score = 115 bits (289), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 82/275 (29%), Positives = 146/275 (53%), Gaps = 26/275 (9%) Query: 6 RVLLADDEPVILRGLKKLISWDTLGLDIVGEARDGIELKAMIDTCAPDLVISDISMPGFS 65 +V+LADDE +IL+GL+ +I W+ LGL+IV +A +G E D+V++DI+MP + Sbjct: 3 KVMLADDENLILQGLENIIEWEELGLEIVNKASNGQEAIDKFKENPVDIVVTDINMPQVT 62 Query: 66 GIDIIRDIHESGRPVKVVFISAYQEFSYARQAIQYGALDYIVKPVNTGQLEQVVGRAVAM 125 G+++++++ + VK + +S Y +FSYA++AI+ G +YI+KP++ +LE+ + + Sbjct: 63 GLELLKELKKINSDVKFIILSGYDDFSYAKKAIELGVENYILKPIDEEELEKTLKNTINK 122 Query: 126 IRQESEEERNKEMLKSYERKHHSITVEELLERLTDGNKGAASTLARMGNIAITRYASVCV 185 I+QE EE NK L H+I ++ + +L G M N+ RY S+C+ Sbjct: 123 IKQEKEE--NKSSLGK-----HNILIKLIKGKLAQGEIEENKEGFYM-NLNSERY-SLCI 173 Query: 186 LETDEYTGQTSRWEERERKLVEFALSNIIKETVETAGNGYVFRKGERFAVLLQHEQETEP 245 + T SR++ E + + N+IKE T N + + +L+ E Sbjct: 174 INT------RSRYDSEE---MLHNIVNVIKEN--TQNNFEIIYTLDEELILINSWDEALS 222 Query: 246 EQIMLDLHHK-----INSYLKLQVSIGIGRPVSGM 275 ++ + + K IN Y + V + +G PV + Sbjct: 223 KKEIKKYYDKLKEQIINEY-GIDVFLSVGEPVCDL 256 >ref|NP_242975.1| BH2109~unknown conserved protein [Bacillus halodurans] pir||E83913 hypothetical protein BH2109 [imported] - Bacillus halodurans (strain C-125) dbj|BAB05828.1| BH2109~unknown conserved protein [Bacillus halodurans] Length = 525 Score = 111 bits (278), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 50/133 (37%), Positives = 85/133 (63%), Gaps = 1/133 (0%) Query: 6 RVLLADDEPVILRGLKKLISWDTLGLDIVGEARDGIELKAMIDTCAPDLVISDISMPGFS 65 +VLLADDE + GLK LI W+ G ++ EA +G + ++ PDLVI+DI MP F Sbjct: 3 KVLLADDEFFVRHGLKSLIEWEKCGYEVAAEADNGEDAFKLVQEIKPDLVITDIRMPVFD 62 Query: 66 GIDIIRDIHES-GRPVKVVFISAYQEFSYARQAIQYGALDYIVKPVNTGQLEQVVGRAVA 124 G+ +I+ ++E+ K + IS Y +FSYA++A+++GA+D+++KP++ +LE + + A Sbjct: 63 GLQLIQKVNETLSFNTKFIIISGYNDFSYAQKAVRFGAVDFVLKPIDQDELEAALIKLAA 122 Query: 125 MIRQESEEERNKE 137 + QE ++E Sbjct: 123 TLDQEKATNSDQE 135 >ref|NP_782430.1| transcriptional regulatory protein [Clostridium tetani E88] gb|AAO36367.1| transcriptional regulatory protein [Clostridium tetani E88] Length = 259 Score = 103 bits (257), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 43/119 (36%), Positives = 77/119 (64%) Query: 5 IRVLLADDEPVILRGLKKLISWDTLGLDIVGEARDGIELKAMIDTCAPDLVISDISMPGF 64 R+++ADDE I GLK LI L L ++ A+DG E +I+ P++++ DI+MP Sbjct: 2 FRIVIADDEDTIRNGLKNLIESYELNLSVIATAKDGEEAMKVIEKYHPEIILMDINMPFM 61 Query: 65 SGIDIIRDIHESGRPVKVVFISAYQEFSYARQAIQYGALDYIVKPVNTGQLEQVVGRAV 123 +G+D+I+ IHE + K++ IS Y +F YA++A++ G +Y++KP+N + ++ +A+ Sbjct: 62 NGLDVIKGIHERNKDAKIIIISGYSQFEYAQKALELGVFNYLLKPINYRDFKDILIKAM 120 >ref|NP_645013.1| ORFID:MW0198~hypothetical protein, similar to two-component response regulator [Staphylococcus aureus subsp. aureus MW2] dbj|BAB94063.1| MW0198 [Staphylococcus aureus subsp. aureus MW2] Length = 252 Score = 103 bits (256), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 49/132 (37%), Positives = 84/132 (63%), Gaps = 3/132 (2%) Query: 5 IRVLLADDEPVILRGLKKLISWDTLGLDIVGEARDGIELKAMIDTCAPDLVISDISMPGF 64 +V++ DDE +I GLK++I W + + A+DG+E ++I P+LVI+DI MP Sbjct: 2 FKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPRK 61 Query: 65 SGIDIIRDIHESGRPVKVVFISAYQEFSYARQAIQYGALDYIVKPVNTGQLEQVVGRAV- 123 +G+D++ DI + V+ +S+Y +F Y + IQ+ LDY++KPV+ QLE ++GR V Sbjct: 62 NGVDLLNDI--AHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVR 119 Query: 124 AMIRQESEEERN 135 ++ Q+S+ R+ Sbjct: 120 TLLEQQSQNGRS 131 >ref|NP_241659.1| two-component sensor response regulator [Bacillus halodurans] pir||A83749 two-component sensor response regulator BH0793 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04512.1| two-component sensor response regulator [Bacillus halodurans] Length = 508 Score = 102 bits (254), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 45/111 (40%), Positives = 74/111 (66%) Query: 5 IRVLLADDEPVILRGLKKLISWDTLGLDIVGEARDGIELKAMIDTCAPDLVISDISMPGF 64 IRV+L DDEP+IL GLK LI W LG +IV AR+G+E + + DL+I+DI MP Sbjct: 2 IRVMLVDDEPLILEGLKHLIDWGQLGYEIVATARNGVEALEIAKYVSFDLLITDIKMPEK 61 Query: 65 SGIDIIRDIHESGRPVKVVFISAYQEFSYARQAIQYGALDYIVKPVNTGQL 115 +G+++I ++E + ++ + +S +QEF + +Q + G +Y++KP+N +L Sbjct: 62 TGLELIAALNEREKTIRSIVLSGFQEFHFVKQGLTLGIENYLLKPINEKEL 112 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 398,924,168 Number of extensions: 15781447 Number of successful extensions: 76436 Number of sequences better than 1.0e-05: 1903 Number of HSP's gapped: 78213 Number of HSP's successfully gapped: 1903 Length of query: 288 Length of database: 757,237,578 Length adjustment: 124 Effective length of query: 164 Effective length of database: 420,565,302 Effective search space: 68972709528 Effective search space used: 68972709528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 125 (52.8 bits)