BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0504.0001.p (175 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_978883.1| conserved hypothetical protein [Bacillus cereus... 139 3e-32 ref|NP_832271.1| hypothetical protein [Bacillus cereus ATCC 1457... 139 4e-32 ref|NP_656439.1| hypothetical protein predicted by GeneMark [Bac... 136 2e-31 ref|NP_463927.1| similar to unknown proteins [Listeria monocytog... 91 8e-18 ref|NP_469765.1| similar to unknown proteins [Listeria innocua] ... 84 1e-15 >ref|NP_978883.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS41491.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 159 Score = 139 bits (350), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 63/158 (39%), Positives = 97/158 (61%) Query: 16 MIAALQASPQGATAVFERYYKHPVNRVWAMLTDNTLLAKWFPELRVQDLSAGGSMKFDMG 75 M+A ++ FERY+ + + VW++LT+N+ L KW L+++ L GG +KFDM Sbjct: 1 MLAVIEKQGNEYVVQFERYFSYSIEEVWSVLTENSKLKKWMSNLQIESLKTGGIIKFDMM 60 Query: 76 DGHFEVMEIKDMILNSILEYTWGNDRVRFELSPDGDGCRLLLIESITEITGHTAKDLSGW 135 DG F ++I + +N++LE+TW D VRFE+ + + LLL E I E+T HT KD++GW Sbjct: 61 DGSFINIDILECQVNAVLEFTWDKDCVRFEIHKEENDTLLLLKEYIHELTDHTPKDIAGW 120 Query: 136 HVCLDVIGVLLDGGELNNRKQVWEQWYAEYTRLVADFR 173 H+CLD+ +L+G E K W+QW+ Y V + R Sbjct: 121 HICLDLFSSVLEGKEKEFSKDEWKQWFEIYKDKVLELR 158 >ref|NP_832271.1| hypothetical protein [Bacillus cereus ATCC 14579] gb|AAP09472.1| hypothetical protein [Bacillus cereus ATCC 14579] Length = 159 Score = 139 bits (349), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 64/158 (40%), Positives = 97/158 (61%) Query: 16 MIAALQASPQGATAVFERYYKHPVNRVWAMLTDNTLLAKWFPELRVQDLSAGGSMKFDMG 75 MIA ++ G FER + + VW++LT+N+ L KW P L+++ L G +KFDM Sbjct: 1 MIAEIRKLTDGYIVKFERQFPYTAEEVWSVLTENSKLKKWMPNLQIESLKTAGIIKFDMM 60 Query: 76 DGHFEVMEIKDMILNSILEYTWGNDRVRFELSPDGDGCRLLLIESITEITGHTAKDLSGW 135 G F ++I + LNS+LE+TW DRVRFE+ + +G LLL E I E+T HT +D++GW Sbjct: 61 GGSFINIDILECQLNSVLEFTWDKDRVRFEIHNEENGTLLLLKEYIHELTDHTPRDVAGW 120 Query: 136 HVCLDVIGVLLDGGELNNRKQVWEQWYAEYTRLVADFR 173 H+CL++ +L+G E K W+QW+ Y + + R Sbjct: 121 HICLNLFSFVLEGEEKEFSKDEWQQWFEIYKDKIHEVR 158 >ref|NP_656439.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_844938.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP26424.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 159 Score = 136 bits (343), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 63/158 (39%), Positives = 94/158 (59%) Query: 16 MIAALQASPQGATAVFERYYKHPVNRVWAMLTDNTLLAKWFPELRVQDLSAGGSMKFDMG 75 M+A + F+R++ + + VW++LT+N+ L KW L+++ L G +KFDM Sbjct: 1 MLAVIDKQNNEYVVQFDRHFSYSIEEVWSVLTENSKLKKWMSNLQIESLKTDGVIKFDMM 60 Query: 76 DGHFEVMEIKDMILNSILEYTWGNDRVRFELSPDGDGCRLLLIESITEITGHTAKDLSGW 135 DG F ++I + NS+LE+TW DRVRFE+ + DG LLL E I +T HT KD++GW Sbjct: 61 DGSFINIDIIECQQNSVLEFTWDKDRVRFEIHKEEDGTLLLLKEYIHVLTDHTPKDIAGW 120 Query: 136 HVCLDVIGVLLDGGELNNRKQVWEQWYAEYTRLVADFR 173 H+CLD+ +L G E K W+QW+ Y V + R Sbjct: 121 HICLDLFSAVLKGEEKEFSKDKWQQWFEIYKGKVFELR 158 >ref|NP_463927.1| similar to unknown proteins [Listeria monocytogenes EGD-e] pir||AF1124 hypothetical protein lmo0397 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC98476.1| lmo0397 [Listeria monocytogenes] Length = 160 Score = 91.3 bits (225), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 1/138 (0%) Query: 31 FERYYKHPVNRVWAMLTDNTLLAKWFPELRVQDLSAGGSMKFDMGDGHFEVMEIKDMILN 90 FE P+ V+A+LT NT LAKWF EL V +L A G + F M M I+ N Sbjct: 17 FEVEISAPIQEVFALLTTNTGLAKWFNELEVGELGADGYLLFVMTPEEKITMPIRAFEPN 76 Query: 91 SILEYTWGNDRVRFELSP-DGDGCRLLLIESITEITGHTAKDLSGWHVCLDVIGVLLDGG 149 L + W D V FEL+ + RL E +T IT H+ +D+SGWH+CL + +G Sbjct: 77 QKLAFEWDQDEVAFELNEITANKTRLTFTEQLTTITEHSPRDISGWHICLKKLQASAEGK 136 Query: 150 ELNNRKQVWEQWYAEYTR 167 + K ++ +A+Y + Sbjct: 137 IYDFNKTEFKTLFAKYQK 154 >ref|NP_469765.1| similar to unknown proteins [Listeria innocua] pir||AE1485 hypothetical protein homolog lin0420 [imported] - Listeria innocua (strain Clip11262) emb|CAC95653.1| lin0420 [Listeria innocua] Length = 160 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 45/130 (34%), Positives = 69/130 (53%), Gaps = 1/130 (0%) Query: 39 VNRVWAMLTDNTLLAKWFPELRVQDLSAGGSMKFDMGDGHFEVMEIKDMILNSILEYTWG 98 V V+++LT N LAKWF EL + +L A G + F M M I+ N + + W Sbjct: 25 VADVFSLLTTNEGLAKWFNELEIGELGANGHLLFIMTPEEKITMPIRAFEPNKKIAFQWD 84 Query: 99 NDRVRFELSP-DGDGCRLLLIESITEITGHTAKDLSGWHVCLDVIGVLLDGGELNNRKQV 157 D V FEL+ G+ +L+ E +T IT H+ +D+SGWHVCL + + + K Sbjct: 85 QDEVAFELNEIAGNKTKLVFTEQLTAITEHSPRDVSGWHVCLKKLQASAEKKTYDFNKAT 144 Query: 158 WEQWYAEYTR 167 +E +A+Y + Sbjct: 145 FETLFAKYQK 154 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 268,759,459 Number of extensions: 11010389 Number of successful extensions: 20442 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 20438 Number of HSP's successfully gapped: 8 Length of query: 175 Length of database: 757,237,578 Length adjustment: 117 Effective length of query: 58 Effective length of database: 439,570,995 Effective search space: 25495117710 Effective search space used: 25495117710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 121 (51.2 bits)