BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0500.0014.p (166 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_831229.1| cAMP-dependent protein kinase regulatory chain ... 192 2e-48 ref|NP_977893.1| transcriptional regulator, putative [Bacillus c... 191 5e-48 ref|NP_655350.1| cNMP_binding, Cyclic nucleotide-binding domain ... 190 1e-47 ref|NP_296083.1| transcriptional regulator [Deinococcus radiodur... 62 5e-09 ref|ZP_00057626.1| COG0664: cAMP-binding proteins - catabolite g... 61 9e-09 >ref|NP_831229.1| cAMP-dependent protein kinase regulatory chain [Bacillus cereus ATCC 14579] gb|AAP08430.1| cAMP-dependent protein kinase regulatory chain [Bacillus cereus ATCC 14579] Length = 170 Score = 192 bits (488), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 1/163 (0%) Query: 1 MILHKGEVLFRQGDACQNLFQVKSGLFKVIRLHENGNMVLFNLLYPGETVPHHSLISPKE 60 MILHKG+VLFRQG+ L+ +K+GL KV+RL ENG LFN++ PGET+PHHSLISPKE Sbjct: 1 MILHKGDVLFRQGEDGP-LYFIKTGLLKVVRLEENGTPFLFNIIVPGETIPHHSLISPKE 59 Query: 61 AHGTAVAMMKSEVELVPAAEWYRELREDPDKVMEIALLLQEKVRFMQTRLDHLTVGTPGE 120 HGTA+A++K+EVE + ++EWY L+ +P+ IA+ LQ K+R MQ R+D LT +P E Sbjct: 60 YHGTAIALIKTEVEPITSSEWYERLQANPESYANIAMQLQSKLRMMQQRIDQLTTVSPKE 119 Query: 121 RLDLLKRWLLEYSHGAELTDLLTQEEIGQLIGVRRETVNRLLR 163 RL L+ W Y + ++LTQ EIGQLIG+RRETVNRLLR Sbjct: 120 RLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLR 162 >ref|NP_977893.1| transcriptional regulator, putative [Bacillus cereus ATCC 10987] gb|AAS40501.1| transcriptional regulator, putative [Bacillus cereus ATCC 10987] Length = 170 Score = 191 bits (485), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 93/163 (57%), Positives = 120/163 (73%), Gaps = 1/163 (0%) Query: 1 MILHKGEVLFRQGDACQNLFQVKSGLFKVIRLHENGNMVLFNLLYPGETVPHHSLISPKE 60 MILHKG+VLFRQG+ L+ +K+GL KV+R+ E+G LFN++ PGET+PHHSLISPKE Sbjct: 1 MILHKGDVLFRQGEDGP-LYFIKTGLLKVVRIEEDGTPFLFNIIVPGETIPHHSLISPKE 59 Query: 61 AHGTAVAMMKSEVELVPAAEWYRELREDPDKVMEIALLLQEKVRFMQTRLDHLTVGTPGE 120 HGTA+A+MK+EVE + + EWY +L+ DP IA+ LQ K+R MQ R+D LT +P E Sbjct: 60 YHGTAIALMKTEVEPIISNEWYNQLQADPASYANIAMQLQSKLRMMQQRIDQLTTVSPKE 119 Query: 121 RLDLLKRWLLEYSHGAELTDLLTQEEIGQLIGVRRETVNRLLR 163 RL L+ W Y + ++LTQ EIGQLIG+RRETVNRLLR Sbjct: 120 RLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLR 162 >ref|NP_655350.1| cNMP_binding, Cyclic nucleotide-binding domain [Bacillus anthracis A2012] ref|NP_843923.1| transcriptional regulator, putative [Bacillus anthracis str. Ames] gb|AAP25409.1| transcriptional regulator, putative [Bacillus anthracis str. Ames] Length = 170 Score = 190 bits (482), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 93/163 (57%), Positives = 120/163 (73%), Gaps = 1/163 (0%) Query: 1 MILHKGEVLFRQGDACQNLFQVKSGLFKVIRLHENGNMVLFNLLYPGETVPHHSLISPKE 60 MILHKG+VLFRQG+ L+ +K+GL KV+RL E+G LFN++ PGET+PHHSLISPKE Sbjct: 1 MILHKGDVLFRQGEDGP-LYFIKTGLLKVVRLEEDGTPFLFNIIVPGETIPHHSLISPKE 59 Query: 61 AHGTAVAMMKSEVELVPAAEWYRELREDPDKVMEIALLLQEKVRFMQTRLDHLTVGTPGE 120 HGTA+A+MK+EVE + + EWY +L+ +P IA+ LQ K+R MQ R+D LT +P E Sbjct: 60 YHGTAIALMKTEVEPIMSNEWYDQLQANPASYANIAMQLQSKLRMMQQRIDQLTTVSPKE 119 Query: 121 RLDLLKRWLLEYSHGAELTDLLTQEEIGQLIGVRRETVNRLLR 163 RL L+ W Y + ++LTQ EIGQLIG+RRETVNRLLR Sbjct: 120 RLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLR 162 >ref|NP_296083.1| transcriptional regulator [Deinococcus radiodurans] pir||C75282 transcription regulator - Deinococcus radiodurans (strain R1) gb|AAF11910.1| transcriptional regulator [Deinococcus radiodurans] Length = 231 Score = 62.0 bits (149), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 48/160 (30%), Positives = 82/160 (51%), Gaps = 7/160 (4%) Query: 6 GEVLFRQGDACQNLFQVKSGLFKVIRLHENGNMVLFNLLYPGETVPHHSLISPKEAHGT- 64 GEV++R D L+ V+SGL K+ +L NG + ++ +T L+ P+E T Sbjct: 39 GEVIYRMDDPADALYFVRSGLVKISKLFPNGKEAILGVVGQHDTF-GELLLQPEERRPTQ 97 Query: 65 AVAMMKSEVELVPAAEWYRELREDPDKVMEIALLLQEKVRFMQTRLDHLTVGTPGERL-D 123 A A+ ++ + ++P E + L PD M++ L+ ++ Q ++ + ER+ Sbjct: 98 AEALERTTLIVLPRQELQKLLSTKPDLAMKLIRLMAARLFEAQAWTATVSAYSAPERVAS 157 Query: 124 LLKRWLLEY----SHGAELTDLLTQEEIGQLIGVRRETVN 159 LL R E+ S G EL L QE+I +++G RETV+ Sbjct: 158 LLYRLAREFGRPHSQGVELNLKLNQEDIARMVGATRETVS 197 >ref|ZP_00057626.1| COG0664: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Thermobifida fusca] Length = 255 Score = 61.2 bits (147), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 54/172 (31%), Positives = 82/172 (47%), Gaps = 19/172 (11%) Query: 3 LHKGEVLFRQGDACQNLFQVKSGLFKVIRLHENGNMVLFNLLYPGETVPHHSLISPKEAH 62 L +G+ LF +GD L+ + SG K+ R +G L +L PGE + SL P Sbjct: 62 LGRGQTLFSEGDEGDRLYVMLSGKVKLTRKSADGRENLLAVLGPGEMLGELSLFDPGPRT 121 Query: 63 GTAVAMMKSEVELVPAAEWYRELREDPDKVMEIALLLQEKVRFMQTRL--------DHLT 114 +AVA+ + V A + +LR + E+A+ L ++ + TRL D + Sbjct: 122 ASAVAVTDA----VLAGLGHDDLRPFIMRQPEVAVHL---LKALATRLRRTNDVVADLVF 174 Query: 115 VGTPGER----LDLLKRWLLEYSHGAELTDLLTQEEIGQLIGVRRETVNRLL 162 PG LDL +R+ + G + LTQEE+ Q +G RETVN+ L Sbjct: 175 TDVPGRVAKALLDLAERFGKQSEDGLHVHHDLTQEELAQFVGASRETVNKAL 226 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 239,123,601 Number of extensions: 9147868 Number of successful extensions: 28492 Number of sequences better than 1.0e-05: 47 Number of HSP's gapped: 28607 Number of HSP's successfully gapped: 47 Length of query: 166 Length of database: 757,237,578 Length adjustment: 116 Effective length of query: 50 Effective length of database: 442,286,094 Effective search space: 22114304700 Effective search space used: 22114304700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 121 (51.2 bits)