BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0490.0035.p (62 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_389464.1| ribosomal protein L28 [Bacillus subtilis] >gi|5... 93 2e-18 ref|NP_243366.1| 50S ribosomal protein L28; ribosomal protein L2... 92 4e-18 ref|NP_692435.1| 50S ribosomal protein L28 [Oceanobacillus iheye... 89 3e-17 ref|NP_471264.1| ribosomal protein L28 [Listeria innocua] >gi|16... 85 6e-16 ref|NP_764454.1| 50S ribosomal protein L28 [Staphylococcus epide... 84 1e-15 >ref|NP_389464.1| ribosomal protein L28 [Bacillus subtilis] sp|P37807|RL28_BACSU 50S ribosomal protein L28 pir||S39982 ribosomal protein L28 (rpmB) - Bacillus subtilis gb|AAC36810.1| ribosomal protein L28 emb|CAA74255.1| putative RpmB protein [Bacillus subtilis] emb|CAB13455.1| ribosomal protein L28 [Bacillus subtilis subsp. subtilis str. 168] Length = 62 Score = 92.8 bits (229), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/62 (70%), Positives = 54/62 (87%) Query: 1 MSRKCTVTGKKPGSGNHVSHANNRNRRSWGVNVQKVRILVNGKPKRVYVSTRALKAGKVE 60 M+RKC +TGKK +GN+ SHA N ++R+WG N+QKVRILVNGKPK+VYVS RALK+GKVE Sbjct: 1 MARKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSARALKSGKVE 60 Query: 61 RV 62 RV Sbjct: 61 RV 62 >ref|NP_243366.1| 50S ribosomal protein L28; ribosomal protein L28 [Bacillus halodurans] sp|Q9K9Z4|RL28_BACHD 50S ribosomal protein L28 pir||D83962 ribosomal protein L28 rpmB [imported] - Bacillus halodurans (strain C-125) dbj|BAB06219.1| 50S ribosomal protein L28 [Bacillus halodurans] Length = 62 Score = 91.7 bits (226), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 44/62 (70%), Positives = 52/62 (83%) Query: 1 MSRKCTVTGKKPGSGNHVSHANNRNRRSWGVNVQKVRILVNGKPKRVYVSTRALKAGKVE 60 M+RKC +TG++ SGN SHA N+ +R WG NVQKVRILV+GKPKRVYVS RALK+GKVE Sbjct: 1 MARKCYITGRQAKSGNKRSHAMNKTKRRWGANVQKVRILVDGKPKRVYVSARALKSGKVE 60 Query: 61 RV 62 RV Sbjct: 61 RV 62 >ref|NP_692435.1| 50S ribosomal protein L28 [Oceanobacillus iheyensis HTE831] dbj|BAC13470.1| 50S ribosomal protein L28 [Oceanobacillus iheyensis HTE831] Length = 62 Score = 89.0 bits (219), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 43/62 (69%), Positives = 52/62 (83%) Query: 1 MSRKCTVTGKKPGSGNHVSHANNRNRRSWGVNVQKVRILVNGKPKRVYVSTRALKAGKVE 60 M+RKC VTG++ SGN SHA N N+R+W NVQKVRI+V+GKPK+VYVS RALK+GKVE Sbjct: 1 MARKCVVTGRQTRSGNQRSHAMNSNKRNWKANVQKVRIMVDGKPKKVYVSARALKSGKVE 60 Query: 61 RV 62 RV Sbjct: 61 RV 62 >ref|NP_471264.1| ribosomal protein L28 [Listeria innocua] ref|NP_465341.1| ribosomal protein L28 [Listeria monocytogenes EGD-e] sp|Q92AJ2|RL28_LISMO 50S ribosomal protein L28 pir||AH1301 ribosomal protein L28 [imported] - Listeria monocytogenes (strain EGD-e) pir||AH1673 ribosomal protein L28 [imported] - Listeria innocua (strain Clip11262) emb|CAC99894.1| ribosomal protein L28 [Listeria monocytogenes] emb|CAC97160.1| ribosomal protein L28 [Listeria innocua] Length = 62 Score = 84.7 bits (208), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 40/62 (64%), Positives = 52/62 (83%) Query: 1 MSRKCTVTGKKPGSGNHVSHANNRNRRSWGVNVQKVRILVNGKPKRVYVSTRALKAGKVE 60 M+++C +TG+K SGN SHA N ++R+W N+QKVRILVNGKPK+V+VS RALK+GKVE Sbjct: 1 MAKECVITGRKSRSGNKRSHAMNSSKRTWKANLQKVRILVNGKPKKVWVSARALKSGKVE 60 Query: 61 RV 62 RV Sbjct: 61 RV 62 >ref|NP_764454.1| 50S ribosomal protein L28 [Staphylococcus epidermidis ATCC 12228] sp|Q8CSV6|RL28_STAEP 50S ribosomal protein L28 gb|AAO04496.1| 50S ribosomal protein L28 [Staphylococcus epidermidis ATCC 12228] Length = 62 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 40/62 (64%), Positives = 50/62 (80%) Query: 1 MSRKCTVTGKKPGSGNHVSHANNRNRRSWGVNVQKVRILVNGKPKRVYVSTRALKAGKVE 60 M ++C VTG+K +GNH SHA N N+R W N+QKVRILV+GKPK+V+VS RALK+GKV Sbjct: 1 MGKQCFVTGRKASTGNHRSHALNANKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVT 60 Query: 61 RV 62 RV Sbjct: 61 RV 62 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.129 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 93,888,264 Number of extensions: 2818088 Number of successful extensions: 6025 Number of sequences better than 1.0e-05: 62 Number of HSP's gapped: 6025 Number of HSP's successfully gapped: 62 Length of query: 62 Length of database: 757,237,578 Length adjustment: 34 Effective length of query: 28 Effective length of database: 664,924,212 Effective search space: 18617877936 Effective search space used: 18617877936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)