BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0483.0002.p (120 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_721149.1| putative transcriptional regulator [Streptococc... 104 8e-22 ref|NP_834840.1| Transcriptional regulator, MerR family [Bacillu... 100 2e-20 ref|NP_981574.1| transcriptional regulator, MerR family [Bacillu... 98 6e-20 ref|NP_653624.1| HTH_MERR, helix_turn_helix, mercury resistance ... 94 1e-18 gb|EAJ47591.1| unknown [environmental sequence] 85 4e-16 >ref|NP_721149.1| putative transcriptional regulator [Streptococcus mutans UA159] gb|AAN58455.1| putative transcriptional regulator [Streptococcus mutans UA159] Length = 127 Score = 104 bits (259), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 52/115 (45%), Positives = 77/115 (66%), Gaps = 3/115 (2%) Query: 1 MKIGELAERTGVSIRSLRYYERQGLITPLRKANGYREYSALAVETVETIKLYLNLGLSTE 60 M+IGE+++ T VS+RSLRYYE +GLI P R NGYR+Y L +E ++T+KLY +LGL+T Sbjct: 1 MRIGEVSKLTNVSMRSLRYYEEKGLIHPERLENGYRDYDKLTLERIKTLKLYFDLGLTTA 60 Query: 61 EIAGFLNC---VLMKKEAFCAEVMPLYRSKLEDIERQLLQLNQIKSNLEERIASI 112 E+ + C V K C +V+ +Y KL+++ Q+ L QI+S L+ER+ I Sbjct: 61 EMQQVMGCDPFVFPYKNLMCKDVIMIYEDKLKEVSHQIQILQQIESRLKERLMKI 115 >ref|NP_834840.1| Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] gb|AAP12041.1| Transcriptional regulator, MerR family [Bacillus cereus ATCC 14579] Length = 122 Score = 99.8 bits (247), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 48/117 (41%), Positives = 81/117 (69%), Gaps = 3/117 (2%) Query: 1 MKIGELAERTGVSIRSLRYYERQGLITPLRKANGYREYSALAVETVETIKLYLNLGLSTE 60 M+IGEL++ TGVS RSLR+YE +GL+ R ANGYR++ A+E VE I++YL +GL+ E Sbjct: 1 MRIGELSKETGVSERSLRHYEEKGLLPSKRLANGYRDFDESAIEKVELIQMYLQIGLNLE 60 Query: 61 EIAGFLNCVLMKKEAF---CAEVMPLYRSKLEDIERQLLQLNQIKSNLEERIASIQQ 114 E A L C+ ++ + C+ ++ LY KL ++ +Q+ L+ I++NL++ ++ ++Q Sbjct: 61 ETARMLRCLEIEPHLYDNPCSSILTLYEDKLNEVTKQITLLSNIQANLQKHVSLLKQ 117 >ref|NP_981574.1| transcriptional regulator, MerR family [Bacillus cereus ATCC 10987] gb|AAS44182.1| transcriptional regulator, MerR family [Bacillus cereus ATCC 10987] Length = 122 Score = 98.2 bits (243), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 51/123 (41%), Positives = 84/123 (68%), Gaps = 4/123 (3%) Query: 1 MKIGELAERTGVSIRSLRYYERQGLITPLRKANGYREYSALAVETVETIKLYLNLGLSTE 60 M+IGEL++ TGVS RSLR+YE +GL+ R ANGYR++ A+E VE I++YL +GL+ E Sbjct: 1 MRIGELSKETGVSERSLRHYEEKGLLPSKRLANGYRDFDESAIEKVELIQMYLQIGLNLE 60 Query: 61 EIAGFLNCVLMKKEAF---CAEVMPLYRSKLEDIERQLLQLNQIKSNLEERIASIQQEQK 117 E A L C+ ++ + C+ ++ LY KL ++ +Q+ L+ I++NL++ + S+ ++ K Sbjct: 61 ETARMLRCLEIEPHLYDNPCSSILTLYEDKLNEVTKQISLLSNIQTNLQKHV-SLLKKAK 119 Query: 118 ESE 120 E E Sbjct: 120 EKE 122 >ref|NP_653624.1| HTH_MERR, helix_turn_helix, mercury resistance [Bacillus anthracis A2012] ref|NP_847580.1| transcriptional regulator, MerR family [Bacillus anthracis str. Ames] gb|AAP29066.1| transcriptional regulator, MerR family [Bacillus anthracis str. Ames] Length = 121 Score = 93.6 bits (231), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/117 (40%), Positives = 81/117 (69%), Gaps = 4/117 (3%) Query: 1 MKIGELAERTGVSIRSLRYYERQGLITPLRKANGYREYSALAVETVETIKLYLNLGLSTE 60 M+IGEL++ TGVS RSLR+YE +GL+ R ANGYR++ A++ VE I++YL +GL+ E Sbjct: 1 MRIGELSKETGVSERSLRHYEEKGLLPSKRLANGYRDFDESAIKKVELIQMYLQIGLNLE 60 Query: 61 EIAGFLNCVLMKKEAF---CAEVMPLYRSKLEDIERQLLQLNQIKSNLEERIASIQQ 114 E A L C+ ++ + C+ ++ LY KL ++ +Q+ L+ I++NL++ ++ ++Q Sbjct: 61 ETARMLRCLEIEPHLYDNPCS-ILTLYEDKLNEVTKQISLLSNIQTNLQKHVSLLKQ 116 >gb|EAJ47591.1| unknown [environmental sequence] Length = 119 Score = 85.1 bits (209), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 68/106 (64%), Gaps = 1/106 (0%) Query: 1 MKIGELAERTGVSIRSLRYYERQGLITPLRKANGYREYSALAVETVETIKLYLNLGLSTE 60 M IGEL++RTG S+RS+R+Y+ GL+ +R +NGYR + AV V+ I+ + G + E Sbjct: 1 MTIGELSQRTGASVRSIRHYDEHGLLASVRASNGYRMFPDKAVAQVKQIQRMIATGFTIE 60 Query: 61 EIAGFLNCVLMKKEA-FCAEVMPLYRSKLEDIERQLLQLNQIKSNL 105 +I GF +C+L+ + A C ++ + R +L I+RQ+ L + ++ L Sbjct: 61 DIRGFPDCMLLIEGARSCDQITDVQRQRLAAIDRQIADLERRRTRL 106 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.133 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 144,775,404 Number of extensions: 4895836 Number of successful extensions: 23321 Number of sequences better than 1.0e-05: 298 Number of HSP's gapped: 23378 Number of HSP's successfully gapped: 298 Length of query: 120 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 36 Effective length of database: 529,169,262 Effective search space: 19050093432 Effective search space used: 19050093432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)