BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0483.0001.p (112 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_518900.1| PUTATIVE THIOREDOXIN PROTEIN [Ralstonia solanac... 91 9e-18 ref|ZP_00147027.1| hypothetical protein Psyc063401 [Psychrobacte... 88 6e-17 ref|NP_371669.1| thioredoxin [Staphylococcus aureus subsp. aureu... 88 7e-17 ref|NP_294668.1| thioredoxin [Deinococcus radiodurans] >gi|74739... 88 8e-17 ref|ZP_00126023.1| COG3118: Thioredoxin domain-containing protei... 86 2e-16 >ref|NP_518900.1| PUTATIVE THIOREDOXIN PROTEIN [Ralstonia solanacearum] emb|CAD14481.1| PUTATIVE THIOREDOXIN PROTEIN [Ralstonia solanacearum] Length = 280 Score = 90.5 bits (223), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 40/83 (48%), Positives = 56/83 (67%) Query: 23 VLVDYGAPWCPPCQTLLPILEELDEEYGSNVTILKVNCDVLPELAAEAGVMGLPTVVVYN 82 VLVD+ APWC PC+TL P+LE+L+ EY + KVN D PEL+A V +P VV + Sbjct: 22 VLVDFWAPWCGPCRTLGPMLEKLEHEYAGKWKLAKVNSDESPELSAHFNVRSIPHVVAFV 81 Query: 83 GGQPMEKLVGLRPKSAYQGVLDR 105 G+P+++ VG+ P+S +G LDR Sbjct: 82 DGKPVDQFVGVLPESQLRGFLDR 104 >ref|ZP_00147027.1| hypothetical protein Psyc063401 [Psychrobacter sp. 273-4] Length = 108 Score = 87.8 bits (216), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 41/102 (40%), Positives = 65/102 (63%) Query: 4 VINTEHADTLRLRLREGGTVLVDYGAPWCPPCQTLLPILEELDEEYGSNVTILKVNCDVL 63 +INT A+ + L+ VLVD+ A WC PC+ + PILE+L EY V I+KV+ D Sbjct: 5 IINTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVDVDNN 64 Query: 64 PELAAEAGVMGLPTVVVYNGGQPMEKLVGLRPKSAYQGVLDR 105 P+ A+ G+ +PT+ V+ GG+ ++ ++GL+PK+ VLD+ Sbjct: 65 PQAASRFGIRNIPTLFVFKGGEKVDSVMGLQPKAELAKVLDK 106 >ref|NP_371669.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374262.1| thioredoxin [Staphylococcus aureus subsp. aureus N315] ref|NP_645845.1| thioredoxin [Staphylococcus aureus subsp. aureus MW2] sp|Q9ZEH4|THIO_STAAM Thioredoxin (TRX) pir||E89885 thioredoxin [imported] - Staphylococcus aureus (strain N315) emb|CAA11404.1| thioredoxin [Staphylococcus aureus] dbj|BAB42241.1| thioredoxin [Staphylococcus aureus subsp. aureus N315] dbj|BAB57307.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94893.1| thioredoxin [Staphylococcus aureus subsp. aureus MW2] Length = 104 Score = 87.8 bits (216), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 43/104 (41%), Positives = 64/104 (61%), Gaps = 2/104 (1%) Query: 2 MAVINTEHADTLRLRLREGGTVLVDYGAPWCPPCQTLLPILEELDEEYGSNVTILKVNCD 61 MA++ AD ++ E G LVD+ A WC PC+ + P+LEEL +Y ILK++ D Sbjct: 1 MAIVKVTDAD-FDSKV-ESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVD 58 Query: 62 VLPELAAEAGVMGLPTVVVYNGGQPMEKLVGLRPKSAYQGVLDR 105 P AA+ VM +PT++V+ GQP++K+VG +PK VLD+ Sbjct: 59 ENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDK 102 >ref|NP_294668.1| thioredoxin [Deinococcus radiodurans] pir||G75455 thioredoxin - Deinococcus radiodurans (strain R1) gb|AAF10520.1| thioredoxin [Deinococcus radiodurans] Length = 141 Score = 87.8 bits (216), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 37/85 (43%), Positives = 57/85 (67%) Query: 21 GTVLVDYGAPWCPPCQTLLPILEELDEEYGSNVTILKVNCDVLPELAAEAGVMGLPTVVV 80 G LVD+ APWC PC+ + P++EEL +Y V + KVN D P + + VM +PT+++ Sbjct: 50 GLTLVDFWAPWCGPCRIIAPVIEELAGQYEGRVKVAKVNVDDNPATSGQFRVMSIPTMIL 109 Query: 81 YNGGQPMEKLVGLRPKSAYQGVLDR 105 + GQP+E +VG +PK A++ VLD+ Sbjct: 110 FKDGQPVEGMVGAQPKRAFESVLDK 134 >ref|ZP_00126023.1| COG3118: Thioredoxin domain-containing protein [Pseudomonas syringae pv. syringae B728a] Length = 255 Score = 86.3 bits (212), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 34/83 (40%), Positives = 56/83 (67%) Query: 23 VLVDYGAPWCPPCQTLLPILEELDEEYGSNVTILKVNCDVLPELAAEAGVMGLPTVVVYN 82 VLVD+ A WC PC+ L+P+L+++ E Y + + KVNCD+ ++ A G+ LPTVV++ Sbjct: 29 VLVDFWAEWCAPCKVLMPLLQQITESYQGELLLAKVNCDIEQDIVARFGIRSLPTVVLFK 88 Query: 83 GGQPMEKLVGLRPKSAYQGVLDR 105 GQP++ G +P+S + +LD+ Sbjct: 89 DGQPVDGFAGAQPESEIRKILDQ 111 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.138 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 173,247,667 Number of extensions: 6814373 Number of successful extensions: 20592 Number of sequences better than 1.0e-05: 950 Number of HSP's gapped: 20755 Number of HSP's successfully gapped: 951 Length of query: 112 Length of database: 757,237,578 Length adjustment: 78 Effective length of query: 34 Effective length of database: 545,459,856 Effective search space: 18545635104 Effective search space used: 18545635104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)