BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0476.0046.p (86 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388669.1| similar to protein-tyrosine phosphatase [Bacill... 80 1e-14 ref|NP_243104.1| protein-tyrosine-phosphatase [Bacillus halodura... 78 5e-14 ref|NP_268359.1| tyrosine phosphatase [Lactococcus lactis subsp.... 73 2e-12 ref|ZP_00035750.1| COG0394: Protein-tyrosine-phosphatase [Entero... 72 4e-12 ref|NP_816670.1| phosphotyrosine protein phosphatase [Enterococc... 72 4e-12 >ref|NP_388669.1| similar to protein-tyrosine phosphatase [Bacillus subtilis] pir||E69808 protein-tyrosine phosphatase homolog yfkJ - Bacillus subtilis dbj|BAA23400.1| YfkJ [Bacillus subtilis] emb|CAB12617.1| yfkJ [Bacillus subtilis subsp. subtilis str. 168] Length = 156 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 42/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%) Query: 1 MKARLVSSDDFRDFDYIICMDQSNGENVRKIPGGRN-ADLLFFMDLLPEEELREVPDPYF 59 M AR VS D DFDYII MD N ++R + G +N + + +D + + +L +VPDPY+ Sbjct: 69 MLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDLADVPDPYY 128 Query: 60 TGNFEEVYRLISAGCDVLLNRIIKEK 85 TGNFEEV +LI GC+ LL I KEK Sbjct: 129 TGNFEEVCQLIKTGCEQLLASIQKEK 154 >ref|NP_243104.1| protein-tyrosine-phosphatase [Bacillus halodurans] pir||F83929 protein-tyrosine-phosphatase BH2238 [imported] - Bacillus halodurans (strain C-125) dbj|BAB05957.1| protein-tyrosine-phosphatase [Bacillus halodurans] Length = 160 Score = 78.2 bits (191), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 40/86 (46%), Positives = 55/86 (63%), Gaps = 1/86 (1%) Query: 1 MKARLVSSDDFRDFDYIICMDQSNGENVRKIPGGRN-ADLLFFMDLLPEEELREVPDPYF 59 +KAR V +D FDY+I MD N N+R I G A++ +D +P + +VPDPYF Sbjct: 69 LKARQVVKEDVHRFDYMIGMDTENVGNLRAIAGATGKAEISRLLDYVPAATIVDVPDPYF 128 Query: 60 TGNFEEVYRLISAGCDVLLNRIIKEK 85 TGNF+EVY LIS GC+ LL I +++ Sbjct: 129 TGNFDEVYDLISEGCERLLAYICEKE 154 >ref|NP_268359.1| tyrosine phosphatase [Lactococcus lactis subsp. lactis] pir||B86900 protein-tyrosine-phosphatase (EC 3.1.3.48) [imported] - Lactococcus lactis subsp. lactis (strain IL1403) gb|AAK06300.1| protein-tyrosine phosphatase (EC 3.1.3.48) [Lactococcus lactis subsp. lactis] Length = 145 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 34/81 (41%), Positives = 54/81 (66%), Gaps = 8/81 (9%) Query: 3 ARLVSSDDFRDFDYIICMDQSNGENVRKI-PGGRNADLLFFMDLLPEEELREVPDPYFTG 61 ++ +SS+DF +FD II MD+SN EN+RK+ P G + + ++ + VPDP+FTG Sbjct: 72 SQKISSEDFYEFDKIIAMDESNLENLRKMAPEGTSQKIAMLLE-------QGVPDPWFTG 124 Query: 62 NFEEVYRLISAGCDVLLNRII 82 +F+E Y+L+ GC LL+ I+ Sbjct: 125 DFQETYQLVKTGCQRLLDEIV 145 >ref|ZP_00035750.1| COG0394: Protein-tyrosine-phosphatase [Enterococcus faecium] Length = 160 Score = 72.0 bits (175), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Query: 1 MKARLVSSDDFRDFDYIICMDQSNGENV-RKIPGGRNADLLFFMDLLPEEELREVPDPYF 59 M AR ++ DF FD+II MDQ N E + R+ P + F+ +P +E VPDPY+ Sbjct: 69 MVARQITPHDFETFDWIIGMDQENVEELKRRAPRSAQGKIHLFLSSIPGKEKENVPDPYY 128 Query: 60 TGNFEEVYRLISAGCDVLLNRIIKE 84 T NF+E Y LI+ G + N I E Sbjct: 129 TNNFDETYHLITEGLNHWWNIWIDE 153 >ref|NP_816670.1| phosphotyrosine protein phosphatase [Enterococcus faecalis V583] gb|AAO82740.1| phosphotyrosine protein phosphatase [Enterococcus faecalis V583] Length = 156 Score = 72.0 bits (175), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Query: 1 MKARLVSSDDFRDFDYIICMDQSNGENVRKI-PGGRNADLLFFMDLLPEEELREVPDPYF 59 M+A + DF+ +DYII MD +N +++ + P + FM+++ +E +VPDPY+ Sbjct: 69 MRATQIQPSDFKKYDYIIGMDTNNVADLKALAPQEEQPRIHLFMEVVAGKETMDVPDPYY 128 Query: 60 TGNFEEVYRLISAGCDVLLNRI 81 TG+FEE YRL+ AG L +I Sbjct: 129 TGDFEETYRLVEAGTSEWLKKI 150 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 146,896,641 Number of extensions: 6032513 Number of successful extensions: 10154 Number of sequences better than 1.0e-05: 43 Number of HSP's gapped: 10212 Number of HSP's successfully gapped: 43 Length of query: 86 Length of database: 757,237,578 Length adjustment: 55 Effective length of query: 31 Effective length of database: 607,907,133 Effective search space: 18845121123 Effective search space used: 18845121123 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)