BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0472.0010.p (139 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_349100.1| Transcriptional regulator, MarR/EmrR family [Cl... 169 3e-41 ref|NP_267638.1| transcription regulator [Lactococcus lactis sub... 144 9e-34 ref|NP_464514.1| similar to regulatory proteins (MarR family) [L... 82 5e-15 ref|NP_470325.1| similar to regulatory proteins (MarR family) [L... 79 3e-14 ref|NP_370857.1| hypothetical protein [Staphylococcus aureus sub... 74 1e-12 >ref|NP_349100.1| Transcriptional regulator, MarR/EmrR family [Clostridium acetobutylicum] pir||E97206 transcription regulator, MarR/EmrR family [imported] - Clostridium acetobutylicum gb|AAK80440.1| Transcriptional regulator, MarR/EmrR family [Clostridium acetobutylicum] Length = 145 Score = 169 bits (427), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 84/137 (61%), Positives = 104/137 (75%) Query: 3 NTPFSDLIREIGLXXXXXXXXRLAELGLNAQQGQMIGYIAEHEDKGLIQKDLAEHFNRKE 62 +TP+S LIR IG+ RLAELGLN+QQG+MIGYI E+++ G+IQKDLA+ F R+ Sbjct: 9 DTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENQESGIIQKDLAQFFGRRG 68 Query: 63 ASITSMLQGLEKKGYIKRVIPKENERQKKIYLLDKAEVLVEEFNEIFAEVEKSITDSLTA 122 ASITSMLQGLEKKGYI+R IP+ N RQK IY+L K LVEEFN IF EVE+SIT LT Sbjct: 69 ASITSMLQGLEKKGYIERRIPENNARQKNIYVLPKGAALVEEFNNIFLEVEESITKGLTK 128 Query: 123 EEAETLMKLLHKVNSNL 139 +E + LM +L KVN ++ Sbjct: 129 DEQKQLMSILIKVNRSM 145 >ref|NP_267638.1| transcription regulator [Lactococcus lactis subsp. lactis] pir||B86810 transcription regulator [imported] - Lactococcus lactis subsp. lactis (strain IL1403) gb|AAK05580.1| transcriptional regulator [Lactococcus lactis subsp. lactis] Length = 139 Score = 144 bits (362), Expect = 9e-34, Method: Compositional matrix adjust. Identities = 73/139 (52%), Positives = 96/139 (69%) Query: 1 MPNTPFSDLIREIGLXXXXXXXXRLAELGLNAQQGQMIGYIAEHEDKGLIQKDLAEHFNR 60 M NT +S+L R I + +L +N QQ ++I YIAE++DKGLIQKDLAE FNR Sbjct: 1 MANTIYSNLFRSISQKSMMTSSQMMKDLEVNHQQARVIAYIAENQDKGLIQKDLAEVFNR 60 Query: 61 KEASITSMLQGLEKKGYIKRVIPKENERQKKIYLLDKAEVLVEEFNEIFAEVEKSITDSL 120 + ASITSMLQGLEKKGYI+R IPKENERQK IY+L K ++ + N+IF EK + + L Sbjct: 61 RGASITSMLQGLEKKGYIERRIPKENERQKNIYILPKGLKIINQINQIFEASEKKLIEPL 120 Query: 121 TAEEAETLMKLLHKVNSNL 139 T +E ++LL K++ NL Sbjct: 121 TEKEQAEFLRLLEKIDDNL 139 >ref|NP_464514.1| similar to regulatory proteins (MarR family) [Listeria monocytogenes EGD-e] pir||AE1198 regulatory proteins (MarR family) homolog lmo0989 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99067.1| lmo0989 [Listeria monocytogenes] Length = 141 Score = 81.6 bits (200), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 45/130 (34%), Positives = 75/130 (57%) Query: 9 LIREIGLXXXXXXXXRLAELGLNAQQGQMIGYIAEHEDKGLIQKDLAEHFNRKEASITSM 68 LIR I + ++A+ GL QQ +++G++ ++ +IQKDL F + ASITS+ Sbjct: 10 LIRSIMIKSKRKMDAKVAQFGLTTQQARVLGFLNDNAANEIIQKDLQRIFQTRGASITSL 69 Query: 69 LQGLEKKGYIKRVIPKENERQKKIYLLDKAEVLVEEFNEIFAEVEKSITDSLTAEEAETL 128 +QGLEKK I R + R+K + L ++ + +V+EFNE F + L+A+E + Sbjct: 70 IQGLEKKQLISRKPSIRDGREKVVTLTEEGKRIVDEFNESFPREDDKAKKILSADEYKIF 129 Query: 129 MKLLHKVNSN 138 + LL K++ N Sbjct: 130 IDLLSKIDDN 139 >ref|NP_470325.1| similar to regulatory proteins (MarR family) [Listeria innocua] pir||AC1556 regulatory protein (MarR family) homolog lin0988 [imported] - Listeria innocua (strain Clip11262) emb|CAC96219.1| lin0988 [Listeria innocua] Length = 141 Score = 79.0 bits (193), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 44/128 (34%), Positives = 74/128 (57%) Query: 9 LIREIGLXXXXXXXXRLAELGLNAQQGQMIGYIAEHEDKGLIQKDLAEHFNRKEASITSM 68 LIR I + ++A+ GL QQ +++G++ ++ +IQKDL F + ASITS+ Sbjct: 10 LIRSIMIKSKRKMDAKVAQFGLTTQQARVLGFLNDNAANEIIQKDLQRIFQTRGASITSL 69 Query: 69 LQGLEKKGYIKRVIPKENERQKKIYLLDKAEVLVEEFNEIFAEVEKSITDSLTAEEAETL 128 +QGLEKK I R + R+K + L + + +V+EFN F + L+A+E +T Sbjct: 70 IQGLEKKQLISRKPSLRDGREKVVTLTKEGKDIVDEFNASFPREDDKAKKILSADEYKTF 129 Query: 129 MKLLHKVN 136 ++LL K++ Sbjct: 130 IELLSKID 137 >ref|NP_370857.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_373568.1| hypothetical protein, similar to transcription regulator [Staphylococcus aureus subsp. aureus N315] ref|NP_645127.1| ORFID:MW0310~hypothetical protein, similar to transcription regulator [Staphylococcus aureus subsp. aureus MW2] pir||G89798 hypothetical protein SA0322 [imported] - Staphylococcus aureus (strain N315) dbj|BAB41546.1| SA0322 [Staphylococcus aureus subsp. aureus N315] dbj|BAB56495.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94175.1| MW0310 [Staphylococcus aureus subsp. aureus MW2] Length = 139 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 42/135 (31%), Positives = 71/135 (52%) Query: 5 PFSDLIREIGLXXXXXXXXRLAELGLNAQQGQMIGYIAEHEDKGLIQKDLAEHFNRKEAS 64 +S L R I +L + + +QG +GY+ H+ GL Q D+A+ R + Sbjct: 4 TYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPT 63 Query: 65 ITSMLQGLEKKGYIKRVIPKENERQKKIYLLDKAEVLVEEFNEIFAEVEKSITDSLTAEE 124 ++++L+ LE+K I R + ++ R+K I L LVE F IF E+E+++ L+ EE Sbjct: 64 VSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEE 123 Query: 125 AETLMKLLHKVNSNL 139 E + L K+ S+L Sbjct: 124 NEQMKANLTKMLSSL 138 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.133 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 171,030,006 Number of extensions: 6045616 Number of successful extensions: 23004 Number of sequences better than 1.0e-05: 51 Number of HSP's gapped: 23054 Number of HSP's successfully gapped: 51 Length of query: 139 Length of database: 757,237,578 Length adjustment: 100 Effective length of query: 39 Effective length of database: 485,727,678 Effective search space: 18943379442 Effective search space used: 18943379442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)