BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0471.0018.p (234 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_981254.1| conserved hypothetical protein [Bacillus cereus... 132 6e-30 ref|NP_391192.1| similar to hypothetical proteins from B. subtil... 131 1e-29 ref|NP_658837.1| hypothetical protein predicted by GeneMark [Bac... 130 2e-29 ref|ZP_00097923.1| COG1842: Phage shock protein A (IM30), suppre... 130 2e-29 ref|NP_834503.1| Phage shock protein A [Bacillus cereus ATCC 145... 130 2e-29 >ref|NP_981254.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS43862.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 221 Score = 132 bits (332), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 77/185 (41%), Positives = 120/185 (64%), Gaps = 2/185 (1%) Query: 1 MGVFQRIKDMTKASVNDLLDKVEDPIVMLNQYLRDMEAEIHEAEVTVAKQMANERRMKQR 60 M VF+R++D+T ++V L++K EDP+ M +QYLRDM+A++ EAE +VA Q+A E++ K Sbjct: 1 MSVFKRLRDLTMSNVYSLIEKAEDPVKMTDQYLRDMQADVQEAEKSVAAQIALEKKFKIL 60 Query: 61 VEEAAKVSGQRAAQAELALKNGQEEVTRKLLEEKIYFDQKHAEYSELHAQAEVQAKELVQ 120 EE + +R QA +A++ ++ R+ LEEK +QK EY + Q +V A L Sbjct: 61 FEEQEALVKKREEQAHMAVQANNLDLARRALEEKQNAEQKMNEYKASYEQNKVAADNLRL 120 Query: 121 QLHDMKDEFYKLRNKRNELVSRAQMAKAKKQMSQISSVHAIESGSASLGFHRMEEKIMQL 180 +L +M+ + +L+NKR LV+R AKA+K ++Q ++ +S SA G RMEEK +QL Sbjct: 121 KLEEMRKQLTELKNKRETLVARVNAAKAQKNINQ--AMSGFDSNSAKAGLSRMEEKALQL 178 Query: 181 EAEAD 185 EAEA+ Sbjct: 179 EAEAE 183 >ref|NP_391192.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] sp|O32201|YVQH_BACSU Hypothetical protein yvqH pir||A70046 conserved hypothetical protein yvqH - Bacillus subtilis emb|CAB15302.1| yvqH [Bacillus subtilis subsp. subtilis str. 168] emb|CAA11741.1| YvqH protein [Bacillus subtilis] Length = 225 Score = 131 bits (330), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 81/195 (41%), Positives = 127/195 (65%), Gaps = 7/195 (3%) Query: 3 VFQRIKDMTKASVNDLLDKVEDPIVMLNQYLRDMEAEIHEAEVTVAKQMANERRMKQRVE 62 V +RI+DM ASV++ LDK+E+P VMLNQY+RDME++I +A+ T+ KQ + K++ E Sbjct: 2 VLKRIRDMFVASVHEGLDKMENPKVMLNQYVRDMESDIAKAKQTIVKQHTIAYQFKKKYE 61 Query: 63 EAAKVSGQRAAQAELALKNGQEEVTRKLLEEKIYFDQKHAEYSELHAQAEVQAKELVQQL 122 EAA+V+G+R QA+LA G+EE+ +K L E Y + K AE+ + QA Q +L +QL Sbjct: 62 EAAEVAGKRKNQAQLAFDAGEEELAKKALTEMKYLEGKAAEHKASYEQANSQLADLKEQL 121 Query: 123 HDMKDEFYKLRNKRNELVSRAQMAKAKKQMSQISSVHAIESGSASLGFHRMEEKIMQLEA 182 ++ + +++K+ L++RA AKAK+ M+ ++ I+S SA F R+E +I ++E Sbjct: 122 AALETKLQDVKDKKQALIARANAAKAKEHMN--TTFDKIDSESAYREFLRIENRIEEME- 178 Query: 183 EADVLRAPYSPSATA 197 +RA YS SA A Sbjct: 179 ----IRANYSKSAEA 189 >ref|NP_658837.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847252.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP28738.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 221 Score = 130 bits (328), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 76/185 (41%), Positives = 119/185 (64%), Gaps = 2/185 (1%) Query: 1 MGVFQRIKDMTKASVNDLLDKVEDPIVMLNQYLRDMEAEIHEAEVTVAKQMANERRMKQR 60 M VF+R++D+T ++V L++K EDP+ M +QYLRDM+A++ EAE +VA Q+A E++ K Sbjct: 1 MSVFKRLRDLTMSNVYSLIEKAEDPVKMTDQYLRDMQADVQEAEKSVAAQIALEKKFKIL 60 Query: 61 VEEAAKVSGQRAAQAELALKNGQEEVTRKLLEEKIYFDQKHAEYSELHAQAEVQAKELVQ 120 EE + +R QA +A++ ++ R+ LEEK +QK EY + Q + A L Sbjct: 61 FEEQEALVKKREEQAHMAVQASNLDLARRALEEKQNAEQKMNEYKASYEQNKAAADNLRL 120 Query: 121 QLHDMKDEFYKLRNKRNELVSRAQMAKAKKQMSQISSVHAIESGSASLGFHRMEEKIMQL 180 +L +M+ + +L+NKR LV+R AKA+K ++Q ++ +S SA G RMEEK +QL Sbjct: 121 KLEEMRKQLTELKNKRETLVARVNAAKAQKNINQ--AMSGFDSNSAKAGLSRMEEKALQL 178 Query: 181 EAEAD 185 EAEA+ Sbjct: 179 EAEAE 183 >ref|ZP_00097923.1| COG1842: Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Desulfitobacterium hafniense] Length = 225 Score = 130 bits (327), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 92/228 (40%), Positives = 141/228 (61%), Gaps = 14/228 (6%) Query: 1 MGVFQRIKDMTKASVNDLLDKVEDPIVMLNQYLRDMEAEIHEAEVTVAKQMANERRMKQR 60 M +F+R+ D +A++N LLDK EDP ML+QYLRDME +I EAEV VAKQ+A + K + Sbjct: 4 MSLFKRVSDNIRANLNSLLDKAEDPEKMLDQYLRDMEEDIAEAEVAVAKQLAVAWKFKAQ 63 Query: 61 VEEAAKVSGQRAAQAELALKNGQEEVTRKLLEEKIYFDQKHAEYSELHAQAEVQAKELVQ 120 +++A + +R AQA AL N +E++ R+ LE+K K E+ H + A++L Sbjct: 64 LDDAVALVEKREAQAMEALGNNREDLARRALEDKKINKAKSEEFRRQHESSSAMAEQLRS 123 Query: 121 QLHDMKDEFYKLRNKRNELVSRAQMAKAKKQMSQISSVHAIESGSASLGFHRMEEKIMQL 180 +L +MK+E+ KLR KR+ LV+RAQ AKA++++ +V + S F RME+K++++ Sbjct: 124 ELKEMKNEYEKLRIKRDTLVARAQAAKAQQEIH--GAVSGLGKDSTRRNFDRMEDKVLRM 181 Query: 181 EAEADVLRAPYSPSATAYSKPVDAE-----KQLKVEEQLAALKSKLNT 223 EAEA V + K +D E K ++E++LAALK +L T Sbjct: 182 EAEAKV-------AGDLREKDLDQELESLGKDAEIEKELAALKERLMT 222 >ref|NP_834503.1| Phage shock protein A [Bacillus cereus ATCC 14579] gb|AAP11704.1| Phage shock protein A [Bacillus cereus ATCC 14579] Length = 221 Score = 130 bits (327), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 81/215 (37%), Positives = 129/215 (60%), Gaps = 2/215 (0%) Query: 1 MGVFQRIKDMTKASVNDLLDKVEDPIVMLNQYLRDMEAEIHEAEVTVAKQMANERRMKQR 60 M VF+R++D+T ++V L++K EDP+ M +QYLRDM+A++ EAE +VA Q+A E++ K Sbjct: 1 MSVFKRLRDLTMSNVYSLIEKAEDPVKMTDQYLRDMQADVQEAEKSVAAQIALEKKFKIL 60 Query: 61 VEEAAKVSGQRAAQAELALKNGQEEVTRKLLEEKIYFDQKHAEYSELHAQAEVQAKELVQ 120 EE + +R QA +A++ ++ R+ LEEK +QK EY + Q + A L Sbjct: 61 FEEQEALVKKREEQAHMAVQANNLDLARRALEEKQNAEQKMNEYKASYEQNKAAADNLRL 120 Query: 121 QLHDMKDEFYKLRNKRNELVSRAQMAKAKKQMSQISSVHAIESGSASLGFHRMEEKIMQL 180 +L +M+ + +L+NKR LV+R AKA+K ++Q ++ +S SA G RMEEK +QL Sbjct: 121 KLEEMRKQLNELKNKRETLVARVNAAKAQKNINQ--AMSGFDSNSAKAGLSRMEEKALQL 178 Query: 181 EAEADVLRAPYSPSATAYSKPVDAEKQLKVEEQLA 215 EAEA+ Y + + K V+++LA Sbjct: 179 EAEAEASGEVYKKEKSLDDEFASLNKNSAVDDELA 213 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.309 0.122 0.313 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 277,699,214 Number of extensions: 9817155 Number of successful extensions: 54187 Number of sequences better than 1.0e-05: 89 Number of HSP's gapped: 54511 Number of HSP's successfully gapped: 89 Length of query: 234 Length of database: 757,237,578 Length adjustment: 122 Effective length of query: 112 Effective length of database: 425,995,500 Effective search space: 47711496000 Effective search space used: 47711496000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 124 (52.4 bits)