BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0471.0005.p (164 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB82458.1| hypothetical protein [Staphylococcus aureus] 107 7e-23 ref|NP_373138.1| conserved hypothetical protein [Staphylococcus ... 107 1e-22 ref|NP_765722.1| conserved hypothetical protein [Staphylococcus ... 103 1e-21 ref|NP_390985.1| similar to hypothetical proteins [Bacillus subt... 98 6e-20 gb|AAD23899.1| putative regulatory protein [Staphylococcus xylosus] 96 3e-19 >emb|CAB82458.1| hypothetical protein [Staphylococcus aureus] Length = 187 Score = 107 bits (268), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 65/161 (40%), Positives = 91/161 (56%), Gaps = 1/161 (0%) Query: 1 MIDAIAQTMDLYGANYSFGQLYGIMFFEDKPMTLEEMKQVMNMSKSNMSYGVRSLIASRM 60 +I++I QTMDLYG N S G LYG M FE MTL+EM+ + MSK +MS GV+ L + Sbjct: 18 VINSIGQTMDLYGTNRSVGNLYGTMVFEG-SMTLDEMRHQLQMSKPSMSAGVKKLQEFDI 76 Query: 61 VTXXXXXXXXXXXYVAETDFFQAFKNFFSLKLQREIDVMQEAMSTVMPELQALIQAADTP 120 V ++AE DFF F+NFF+ K QREID+ EA+ + +L++++D Sbjct: 77 VKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAVKDAQAIINSLLESSDLT 136 Query: 121 EEERQACLRDLDKLQHAVEYYAWLQRFVSGLEEGEFFGRLP 161 E E Q + +L H YY WL++ +E GE F P Sbjct: 137 EAETQEAQKIKAQLDHTHVYYEWLEQLTEAIESGEIFKYFP 177 >ref|NP_373138.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375733.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_647350.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] pir||F90068 conserved hypothetical protein SA2407 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43712.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB58776.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB96398.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 188 Score = 107 bits (266), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 65/161 (40%), Positives = 90/161 (55%), Gaps = 1/161 (0%) Query: 1 MIDAIAQTMDLYGANYSFGQLYGIMFFEDKPMTLEEMKQVMNMSKSNMSYGVRSLIASRM 60 +I++I QTMDLYG N S G LYG M FE MTL+EM+ + MSK +MS GV+ L + Sbjct: 19 VINSIGQTMDLYGTNRSVGNLYGTMVFEGS-MTLDEMRHQLQMSKPSMSAGVKKLQEFDI 77 Query: 61 VTXXXXXXXXXXXYVAETDFFQAFKNFFSLKLQREIDVMQEAMSTVMPELQALIQAADTP 120 V ++AE DFF F+NFF+ K QREID+ EA+ + L++++D Sbjct: 78 VKQQFTRGSRKQHFIAEKDFFIFFRNFFTKKFQREIDINVEAVKDAQAIINPLLESSDLT 137 Query: 121 EEERQACLRDLDKLQHAVEYYAWLQRFVSGLEEGEFFGRLP 161 E E Q + +L H YY WL++ +E GE F P Sbjct: 138 EAETQEAQKIKAQLDHTHVYYEWLEQLTEAIESGEIFKYFP 178 >ref|NP_765722.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO05809.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 188 Score = 103 bits (258), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 65/161 (40%), Positives = 90/161 (55%), Gaps = 1/161 (0%) Query: 1 MIDAIAQTMDLYGANYSFGQLYGIMFFEDKPMTLEEMKQVMNMSKSNMSYGVRSLIASRM 60 +I++I +TMDLYG N S G LYGIM FE MTL+EM+Q + MSK +MS GV+ L + Sbjct: 19 VINSIGETMDLYGINRSVGNLYGIMVFE-GSMTLDEMRQQLQMSKPSMSTGVKKLQEYDI 77 Query: 61 VTXXXXXXXXXXXYVAETDFFQAFKNFFSLKLQREIDVMQEAMSTVMPELQALIQAADTP 120 V ++AE DFF F+NFF+ K +REID EA+ + L++ D Sbjct: 78 VKQQFTRGSRKQHFIAEKDFFTFFRNFFTKKWEREIDTNMEAIEDAENIIHPLLEKNDID 137 Query: 121 EEERQACLRDLDKLQHAVEYYAWLQRFVSGLEEGEFFGRLP 161 EE ++ + +L H+ YY WL + LE GE F P Sbjct: 138 EEVKKQAINVKAQLDHSKIYYKWLAQLSEALESGEIFNYFP 178 >ref|NP_390985.1| similar to hypothetical proteins [Bacillus subtilis] sp|P71015|YUAC_BACSU Hypothetical protein yuaC (ORF2) pir||E70005 conserved hypothetical protein yuaC - Bacillus subtilis gb|AAC44366.1| ORF-2 upstream of gbsAB operon emb|CAB15085.1| yuaC [Bacillus subtilis subsp. subtilis str. 168] Length = 180 Score = 98.2 bits (243), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 62/161 (38%), Positives = 92/161 (57%), Gaps = 1/161 (0%) Query: 1 MIDAIAQTMDLYGANYSFGQLYGIMFFEDKPMTLEEMKQVMNMSKSNMSYGVRSLIASRM 60 +ID+IA+TMDLYG S G LYG M+ D+ MTL+EM++ + MSK +MS GV+ L + Sbjct: 17 VIDSIAETMDLYGITRSVGILYGTMYMRDE-MTLDEMREELQMSKPSMSTGVKKLQDLNV 75 Query: 61 VTXXXXXXXXXXXYVAETDFFQAFKNFFSLKLQREIDVMQEAMSTVMPELQALIQAADTP 120 V +VAE DFF+ F NFF K +RE+ V A+ +LQ ++ D Sbjct: 76 VKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKVLCKEDLD 135 Query: 121 EEERQACLRDLDKLQHAVEYYAWLQRFVSGLEEGEFFGRLP 161 E+ + L+ D+L+ + YY WL+R ++ GE F +P Sbjct: 136 EDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIP 176 >gb|AAD23899.1| putative regulatory protein [Staphylococcus xylosus] Length = 186 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 62/161 (38%), Positives = 87/161 (54%), Gaps = 1/161 (0%) Query: 1 MIDAIAQTMDLYGANYSFGQLYGIMFFEDKPMTLEEMKQVMNMSKSNMSYGVRSLIASRM 60 +I+AI +TMDLYG N S G L+G M FED MTL+EM++ + MSK +MS GV+ L + Sbjct: 18 VINAIGETMDLYGINRSVGNLFGTMLFEDS-MTLDEMREQLQMSKPSMSAGVKRLQEFDI 76 Query: 61 VTXXXXXXXXXXXYVAETDFFQAFKNFFSLKLQREIDVMQEAMSTVMPELQALIQAADTP 120 V ++AE DFF F+NFF+ K +REI + EA+ + L +I + Sbjct: 77 VKQQFTRGSRKQHFIAEKDFFNFFRNFFTRKWRREIVINAEAVHDSVAILDKIISDTNVD 136 Query: 121 EEERQACLRDLDKLQHAVEYYAWLQRFVSGLEEGEFFGRLP 161 E + L +L + YY WL + LE GE F P Sbjct: 137 EATKSEALETKQQLVGTLPYYEWLDQLSDALESGEIFKYFP 177 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 205,595,502 Number of extensions: 6520291 Number of successful extensions: 18553 Number of sequences better than 1.0e-05: 9 Number of HSP's gapped: 18546 Number of HSP's successfully gapped: 9 Length of query: 164 Length of database: 757,237,578 Length adjustment: 116 Effective length of query: 48 Effective length of database: 442,286,094 Effective search space: 21229732512 Effective search space used: 21229732512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 121 (51.2 bits)