BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0470.0034.p (71 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00063421.1| COG0765: ABC-type amino acid transport system... 64 8e-10 ref|NP_465870.1| similar to amino acid ABC transporter (permease... 64 1e-09 ref|NP_471771.1| similar to amino acid ABC transporter (permease... 63 2e-09 ref|NP_720903.1| putative amino acid ABC transporter, permease [... 63 2e-09 ref|NP_687326.1| amino acid ABC transporter, permease protein [S... 61 6e-09 >ref|ZP_00063421.1| COG0765: ABC-type amino acid transport system, permease component [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 234 Score = 64.3 bits (155), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 49/67 (73%) Query: 1 VIGMLHGSTLAFTVSVVDINAQAQIVASTNWKFFEAYLAAALIFWGLTFLIERATALIEK 60 +I ++ G+ +A +SVV+I + A AS+N+K+FEAY+AAA+I+W +T +IERA L+E Sbjct: 166 LINLIKGTAIASLISVVEIFSTATQAASSNYKYFEAYIAAAIIYWLMTIVIERAAVLLEG 225 Query: 61 RINLYNR 67 R++ R Sbjct: 226 RMDKKTR 232 >ref|NP_465870.1| similar to amino acid ABC transporter (permease) [Listeria monocytogenes EGD-e] pir||AC1368 amino acid ABC transporter (permease) homolog lmo2347 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD00425.1| lmo2347 [Listeria monocytogenes] Length = 235 Score = 63.5 bits (153), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 1/70 (1%) Query: 2 IGMLHGSTLAFTVSVVDINAQAQIVASTNWKFFEAYLAAALIFWGLTFLIERATALIEKR 61 IG LH +++A V+V +I A IVAS N+ F EA++ AALI+W LT LIE ++EK Sbjct: 167 IGFLHTTSIAAIVAVPEITGMATIVASDNYAFLEAFIGAALIYWFLTILIEAINYILEKN 226 Query: 62 INLYNRGGVI 71 I Y RGG + Sbjct: 227 IAKY-RGGTV 235 >ref|NP_471771.1| similar to amino acid ABC transporter (permease) [Listeria innocua] pir||AD1737 amino acid ABC transporter (permease) homolog lin2441 [imported] - Listeria innocua (strain Clip11262) emb|CAC97668.1| lin2441 [Listeria innocua] Length = 235 Score = 63.2 bits (152), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 44/69 (63%) Query: 2 IGMLHGSTLAFTVSVVDINAQAQIVASTNWKFFEAYLAAALIFWGLTFLIERATALIEKR 61 IG LH +++A V+V +I A IVAS N+ F EA++ AALI+W LT LIE ++EK Sbjct: 167 IGFLHTTSIAAIVAVPEITGMATIVASDNYAFLEAFIGAALIYWFLTILIEAINYILEKN 226 Query: 62 INLYNRGGV 70 I Y G V Sbjct: 227 IAKYQGGTV 235 >ref|NP_720903.1| putative amino acid ABC transporter, permease [Streptococcus mutans UA159] gb|AAN58209.1| putative amino acid ABC transporter, permease [Streptococcus mutans UA159] Length = 267 Score = 63.2 bits (152), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 52/71 (73%) Query: 1 VIGMLHGSTLAFTVSVVDINAQAQIVASTNWKFFEAYLAAALIFWGLTFLIERATALIEK 60 +IG+ G++LAF +V++ AQAQI+ +++++FE +++ A+I+WG++ +IE+ LIEK Sbjct: 187 LIGLTKGTSLAFNAGIVEMFAQAQILGGSDYRYFERFISVAIIYWGVSIIIEQVGRLIEK 246 Query: 61 RINLYNRGGVI 71 ++ + + ++ Sbjct: 247 KMEIVSPDHIV 257 >ref|NP_687326.1| amino acid ABC transporter, permease protein [Streptococcus agalactiae 2603V/R] ref|NP_734750.1| Unknown [Streptococcus agalactiae NEM316] gb|AAM99198.1| amino acid ABC transporter, permease protein [Streptococcus agalactiae 2603V/R] emb|CAD45926.1| Unknown [Streptococcus agalactiae NEM316] Length = 267 Score = 61.2 bits (147), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 47/62 (75%) Query: 1 VIGMLHGSTLAFTVSVVDINAQAQIVASTNWKFFEAYLAAALIFWGLTFLIERATALIEK 60 +IG+ G++LAF +V++ AQAQI+ +++++FE Y++ AL++W ++FLIE+ IE+ Sbjct: 189 LIGLTKGTSLAFNAGIVEMFAQAQIMGGSDYRYFERYISVALVYWAVSFLIEQLGNAIER 248 Query: 61 RI 62 ++ Sbjct: 249 KM 250 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.328 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 90,267,433 Number of extensions: 2397656 Number of successful extensions: 7541 Number of sequences better than 1.0e-05: 21 Number of HSP's gapped: 7543 Number of HSP's successfully gapped: 21 Length of query: 71 Length of database: 757,237,578 Length adjustment: 42 Effective length of query: 29 Effective length of database: 643,203,420 Effective search space: 18652899180 Effective search space used: 18652899180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 120 (50.8 bits)