BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0444.0016.p (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00100010.1| COG4753: Response regulator containing CheY-l... 86 2e-15 ref|NP_621980.1| CheY-like receiver domains [Thermoanaerobacter ... 86 3e-15 ref|NP_691699.1| hypothetical protein OB0778 [Oceanobacillus ihe... 85 4e-15 ref|NP_435418.1| putative AraC-type regulator [Sinorhizobium mel... 84 1e-14 gb|EAF89925.1| unknown [environmental sequence] 83 1e-14 >ref|ZP_00100010.1| COG4753: Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Desulfitobacterium hafniense] Length = 289 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (1%) Query: 412 LQQLQEGGKKIDSSISR-IIQHMREDLSYP-YKLEELAASMNYSVPYFSSMFKKAVGESF 469 L+QL+ GG + I+Q M LS P + L LA ++N S Y S++FK+ G F Sbjct: 169 LKQLEHGGNEGHHHYREMILQVMNHSLSDPAFSLGRLAEAINLSSGYLSTVFKQNFGIPF 228 Query: 470 VQYLTRLRIEKAKLLLLTTDHKTFEISESIGFENYRSFNRIFKKETGVSPSDYR 523 +YLT +R+E++K+LLL T +K +EI+E +GF++ F+ FKK G+SP+ YR Sbjct: 229 QEYLTTMRLERSKILLLVTSYKIYEIAEKVGFDDPSYFSTCFKKRYGLSPNSYR 282 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 40/144 (27%), Positives = 74/144 (51%), Gaps = 7/144 (4%) Query: 1 VEDEIPARTVFRHFIEERGDLFTLVGEAEDGQDGLELFLKHKPELIVTDITMPGMNGLEM 60 V+DE R + I + + V EAEDG L++ + +P++++ DI MP ++GL + Sbjct: 37 VDDEPIIRQGIKQLINFQEQSISEVYEAEDGALALDIVKEKRPDIVLADINMPNLDGLNL 96 Query: 61 LREIEKSGERPPQIIILTCHQDFHYAQQAIHLKAASYLIKDDCLSDPGLLTRTMEQLASQ 120 REI K+ + ++ ++T + F YA A+ YL+K SD +E L+ Sbjct: 97 AREI-KAVDPEIRVAVITGYDYFEYAVTALKAGVDDYLLKPVSRSD------ILELLSKL 149 Query: 121 VHSIDETREKQLQLEQQVRLSEVE 144 V+ + E E++ ++ L ++E Sbjct: 150 VNDLKEKTEQRRAMDSLASLKQLE 173 >ref|NP_621980.1| CheY-like receiver domains [Thermoanaerobacter tengcongensis] gb|AAM23584.1| CheY-like receiver domains [Thermoanaerobacter tengcongensis] Length = 529 Score = 85.5 bits (210), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 44/104 (42%), Positives = 65/104 (62%) Query: 420 KKIDSSISRIIQHMREDLSYPYKLEELAASMNYSVPYFSSMFKKAVGESFVQYLTRLRIE 479 KK D+ ++I + E+ S LE+ A +N S YFS FK+ VGE+FV YLT LRI Sbjct: 423 KKWDNITMKVINFLEENFSKDISLEDAAREVNMSYHYFSKFFKEQVGENFVDYLTNLRIR 482 Query: 480 KAKLLLLTTDHKTFEISESIGFENYRSFNRIFKKETGVSPSDYR 523 KAK LL + E+S +G+ + F++IFKK TGV+P++++ Sbjct: 483 KAKELLKNSSLSVKEVSYKVGYSDPNYFSKIFKKVTGVTPTEFK 526 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 22/168 (13%) Query: 2 EDEIPARTVFRHFIEERGDLFTLVGEAEDGQDGLELFLKHKPELIVTDITMPGMNGLEML 61 +DE + IE+ +VG A+ G++ +E KP+LI DI MPG++G+E + Sbjct: 8 DDEQIVLDSIKFIIEKNNVQAEIVGTAKSGREAIEKADLLKPDLIFMDIRMPGIDGIEAI 67 Query: 62 REIEKSGERPPQII--ILTCHQDFHYAQQAIHLKAASYLIKDDCLSDPGLLTRTMEQLAS 119 R+I+ ER ++I I+T ++ F+YA++AI L YL+K P + +E + Sbjct: 68 RQIK---ERHKEMIFVIITAYEYFNYAKEAIDLGVMDYLLK------PLNKNKIIEVIEK 118 Query: 120 QVHSIDETREKQLQLEQQVRLSEVEIEQSLFLDMLLNPAAEAKWLRTL 167 I+E R + L+E+E+ + + M P E ++L T+ Sbjct: 119 ASKVIEERR--------KAVLTEIELREKINKIM---PYLEEQFLYTV 155 >ref|NP_691699.1| hypothetical protein OB0778 [Oceanobacillus iheyensis HTE831] dbj|BAC12734.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 517 Score = 85.1 bits (209), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 42/108 (38%), Positives = 71/108 (65%) Query: 420 KKIDSSISRIIQHMREDLSYPYKLEELAASMNYSVPYFSSMFKKAVGESFVQYLTRLRIE 479 +K D I + +++ E K++E+A +N S YFS++FK+ GE+F +Y+ +LR+E Sbjct: 408 EKADWLIKQAERYINEYFRTTIKVQEVADVINVSSNYFSTLFKQKTGENFNEYVNKLRVE 467 Query: 480 KAKLLLLTTDHKTFEISESIGFENYRSFNRIFKKETGVSPSDYRRNGA 527 +AK LL+ T K EIS +GF+ Y+ F +FKK +G++P++YR+ A Sbjct: 468 EAKSLLINTPFKVSEISIQVGFQEYKYFVSVFKKFSGLTPTNYRKLTA 515 >ref|NP_435418.1| putative AraC-type regulator [Sinorhizobium meliloti 1021] pir||D95283 probable AraC-type regulator [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymA gb|AAK64830.1| putative AraC-type regulator [Sinorhizobium meliloti] Length = 333 Score = 83.6 bits (205), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 40/100 (40%), Positives = 62/100 (62%) Query: 426 ISRIIQHMREDLSYPYKLEELAASMNYSVPYFSSMFKKAVGESFVQYLTRLRIEKAKLLL 485 + R + H+ E L+ P+ L +LA ++ S +FS +FKKA G S +Y R R+ +A+LLL Sbjct: 234 LRRAVAHLEEHLAEPFNLAQLAETVGMSEFHFSRLFKKATGLSPSRYFIRQRVARAQLLL 293 Query: 486 LTTDHKTFEISESIGFENYRSFNRIFKKETGVSPSDYRRN 525 TD EI S+G+ + F ++F++ETG+ PS YRR Sbjct: 294 QETDTSIIEIGMSVGYSSPSHFAQVFRRETGLPPSHYRRG 333 >gb|EAF89925.1| unknown [environmental sequence] Length = 210 Score = 83.2 bits (204), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 51/142 (35%), Positives = 85/142 (59%), Gaps = 10/142 (7%) Query: 1 VEDEIPARTVFRHFIEERGDLFTLVGEAEDGQDGLELFLKHKPELIVTDITMPGMNGLEM 60 V+DE AR+ F+ I G + +VGE E+GQ+ +E K+K ++ D+ MPGM+GLE+ Sbjct: 6 VDDERLARSEFKTLISTIGGI-DIVGECENGQEAIEFVKKNKVDVAFLDMEMPGMSGLEV 64 Query: 61 LREIEKSGERPPQIIILTCHQDFHYAQQAIHLKAASYLIKDDCLSDPGLLTRTMEQLASQ 120 E+E+ E I+ +T H+ +YA A ++ AA YL+K +P L +T+E+L Q Sbjct: 65 AEELEQEVE----IVFVTAHE--NYALDAFNVNAADYLLKP---LNPNKLLKTIEKLQKQ 115 Query: 121 VHSIDETREKQLQLEQQVRLSE 142 ++ E +K L+LE ++ L + Sbjct: 116 FDTLAEASKKVLKLEDKIFLKD 137 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 724,237,480 Number of extensions: 28153649 Number of successful extensions: 80402 Number of sequences better than 1.0e-05: 831 Number of HSP's gapped: 81662 Number of HSP's successfully gapped: 871 Length of query: 531 Length of database: 757,237,578 Length adjustment: 130 Effective length of query: 401 Effective length of database: 404,274,708 Effective search space: 162114157908 Effective search space used: 162114157908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 128 (53.9 bits)