BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0443.0017.p (750 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00060114.1| COG2197: Response regulator containing a CheY... 75 4e-12 ref|NP_765084.1| two-component response regulator-like protein [... 72 6e-11 ref|ZP_00181132.1| hypothetical protein Mther087501 [Moorella th... 68 8e-10 ref|NP_488675.1| two-component response regulator [Nostoc sp. PC... 67 1e-09 ref|NP_388814.1| similar to two-component response regulator [Yh... 65 5e-09 >ref|ZP_00060114.1| COG2197: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Clostridium thermocellum ATCC 27405] Length = 216 Score = 75.5 bits (184), Expect = 4e-12, Method: Composition-based stats. Identities = 39/65 (60%), Positives = 46/65 (70%) Query: 676 KSPKEEWGISPREEEVLELIILGKTNKEIASALFISEHTVKNHLSRIFNKMNVTDRSQII 735 K+ K E ++PRE EVLELI G NKEIA LFISE TVKNH+S IF K+NV+DR+Q Sbjct: 147 KAKKTENDLTPRELEVLELIAQGLINKEIAKRLFISEKTVKNHVSNIFKKLNVSDRTQAA 206 Query: 736 ALIYK 740 YK Sbjct: 207 IYAYK 211 >ref|NP_765084.1| two-component response regulator-like protein [Staphylococcus epidermidis ATCC 12228] gb|AAO05128.1| two-component response regulator-like protein [Staphylococcus epidermidis ATCC 12228] Length = 207 Score = 71.6 bits (174), Expect = 6e-11, Method: Composition-based stats. Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 3/82 (3%) Query: 659 QQEQAVSP-GKLLNSAALKSPKEEWGISPREEEVLELIILGKTNKEIASALFISEHTVKN 717 Q E+ + P K + A K P +S RE+EVL+ ++ GKTNKEIA ALF+SE TVK Sbjct: 121 QGERIIHPQAKSVIKAVSKKPHYTNKLSKREKEVLKEMVKGKTNKEIARALFVSEKTVKT 180 Query: 718 HLSRIFNKMNVTDRSQIIALIY 739 H+S IF+K+ V+DR+Q A IY Sbjct: 181 HVSHIFSKLEVSDRTQ--AAIY 200 >ref|ZP_00181132.1| hypothetical protein Mther087501 [Moorella thermoacetica ATCC 39073] Length = 100 Score = 68.2 bits (165), Expect = 8e-10, Method: Composition-based stats. Identities = 34/66 (51%), Positives = 45/66 (68%) Query: 684 ISPREEEVLELIILGKTNKEIASALFISEHTVKNHLSRIFNKMNVTDRSQIIALIYKRIL 743 ++ RE E+L + LGK+N+EIA LFISE TVKNHL+ IF+K+ V+DR+Q K L Sbjct: 35 LTAREREILIHVSLGKSNREIARELFISEKTVKNHLTHIFHKIGVSDRTQAALYALKHGL 94 Query: 744 NSEGLE 749 N LE Sbjct: 95 NDAKLE 100 >ref|NP_488675.1| two-component response regulator [Nostoc sp. PCC 7120] pir||AC2385 two-component response regulator all4635 [imported] - Nostoc sp. (strain PCC 7120) dbj|BAB76334.1| two-component response regulator [Nostoc sp. PCC 7120] Length = 219 Score = 67.4 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Query: 677 SPKEEWGISPREEEVLELIILGKTNKEIASALFISEHTVKNHLSRIFNKMNVTDRSQ--I 734 +P ++PRE+EVL LI G N+EIA L+ISE TVKNH++ I N++N+ DR+Q I Sbjct: 147 APTHLADLTPREKEVLRLIAAGANNREIAQQLYISEGTVKNHVTNILNRLNLRDRTQAAI 206 Query: 735 IALIYKRILN 744 IA Y LN Sbjct: 207 IANTYLNYLN 216 >ref|NP_388814.1| similar to two-component response regulator [YhcY] [Bacillus subtilis] pir||F69824 two-component response regulator [YhcY] homolog yhcZ - Bacillus subtilis emb|CAA74433.1| hypothetical protein [Bacillus subtilis] emb|CAB12761.1| yhcZ [Bacillus subtilis subsp. subtilis str. 168] Length = 214 Score = 65.5 bits (158), Expect = 5e-09, Method: Composition-based stats. Identities = 42/108 (38%), Positives = 61/108 (56%), Gaps = 6/108 (5%) Query: 641 EELLASFQSFILSRSGDQQQEQAVSPGKLLNSAALKSPKEE--WGISPREEEVLELIILG 698 EEL+ + Q G+ + A+ P L + P++E + ++ RE++VL I G Sbjct: 108 EELVKTRQV----HGGEYKLSTAIMPHVLTHMKNQHDPEKEKYYQLTRREKDVLTEIANG 163 Query: 699 KTNKEIASALFISEHTVKNHLSRIFNKMNVTDRSQIIALIYKRILNSE 746 K+NKEIA+ALFISE TVK H+S + K+ V DR+Q K LN E Sbjct: 164 KSNKEIAAALFISEKTVKTHVSNLLAKLEVADRTQAALFAVKYNLNGE 211 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 1,024,762,811 Number of extensions: 41487595 Number of successful extensions: 94066 Number of sequences better than 1.0e-05: 119 Number of HSP's gapped: 94072 Number of HSP's successfully gapped: 119 Length of query: 750 Length of database: 757,237,578 Length adjustment: 133 Effective length of query: 617 Effective length of database: 396,129,411 Effective search space: 244411846587 Effective search space used: 244411846587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 130 (54.7 bits)