BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0440.0017.p (91 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_658087.1| PTS-HPr, PTS HPr component phosphorylation site... 66 3e-10 ref|NP_980410.1| phosphocarrier protein HPr [Bacillus cereus ATC... 65 4e-10 ref|NP_389273.1| histidine-containing phosphocarrier protein of ... 65 4e-10 pdb|2HID| Refined Nmr Structure Of Phosphocarrier Histidine Con... 65 6e-10 pdb|2HPR| Histidine-Containing Phosphocarrier Protein Hpr Mutan... 64 1e-09 >ref|NP_658087.1| PTS-HPr, PTS HPr component phosphorylation site [Bacillus anthracis A2012] ref|NP_833767.1| Phosphocarrier protein HPr [Bacillus cereus ATCC 14579] ref|NP_846502.1| phosphocarrier protein HPr [Bacillus anthracis str. Ames] gb|AAG49026.1| PtsH [Bacillus thuringiensis] gb|AAP10968.1| Phosphocarrier protein HPr [Bacillus cereus ATCC 14579] gb|AAP27988.1| phosphocarrier protein HPr [Bacillus anthracis str. Ames] Length = 87 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Query: 1 MQKTFRITDEDGIHARPATTLVNTATKYKNTEAFAEARGKKVTLKSILGVLSXXXXXXXX 60 M+K F++T + GIHARPAT LVNTA+K+ ++ E GK V LKSI+GV+S Sbjct: 1 MEKIFKVTSDSGIHARPATLLVNTASKF-GSDINLEYNGKNVNLKSIMGVMSLGIQQNAE 59 Query: 61 XXXXXXXXXXXXXXXXXQEVMVKEGLGE 88 +E M EGLGE Sbjct: 60 IKITANGDDAAQALAAIEETMKNEGLGE 87 >ref|NP_980410.1| phosphocarrier protein HPr [Bacillus cereus ATCC 10987] gb|AAS43018.1| phosphocarrier protein HPr [Bacillus cereus ATCC 10987] Length = 87 Score = 65.5 bits (158), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Query: 1 MQKTFRITDEDGIHARPATTLVNTATKYKNTEAFAEARGKKVTLKSILGVLSXXXXXXXX 60 M+K F++T + GIHARPAT LVNTA+K+ ++ E GK V LKSI+GV+S Sbjct: 1 MEKIFKVTSDSGIHARPATLLVNTASKF-GSDINLEYNGKNVNLKSIMGVMSLGIQQGAE 59 Query: 61 XXXXXXXXXXXXXXXXXQEVMVKEGLGE 88 +E M EGLGE Sbjct: 60 IKITANGDDAAQALAAIEETMKNEGLGE 87 >ref|NP_389273.1| histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) [Bacillus subtilis] sp|P08877|PTHP_BACSU Phosphocarrier protein HPr (Histidine-containing protein) pir||WQBSPH phosphotransferase system phosphohistidine-containing protein [validated] - Bacillus subtilis emb|CAA31317.1| Hpr protein [Bacillus subtilis] emb|CAB13263.1| histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) [Bacillus subtilis subsp. subtilis str. 168] Length = 88 Score = 65.5 bits (158), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 37/87 (42%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Query: 2 QKTFRITDEDGIHARPATTLVNTATKYKNTEAFAEARGKKVTLKSILGVLSXXXXXXXXX 61 QKTF++T + GIHARPAT LV TA+KY + + E GK V LKSI+GV+S Sbjct: 3 QKTFKVTADSGIHARPATVLVQTASKY-DADVNLEYNGKTVNLKSIMGVMSLGIAKGAEI 61 Query: 62 XXXXXXXXXXXXXXXXQEVMVKEGLGE 88 +E M EGLGE Sbjct: 62 TISASGADENDALNALEETMKSEGLGE 88 >pdb|2HID| Refined Nmr Structure Of Phosphocarrier Histidine Containing Protein From Bacillus Subtilis Length = 87 Score = 64.7 bits (156), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 37/87 (42%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Query: 2 QKTFRITDEDGIHARPATTLVNTATKYKNTEAFAEARGKKVTLKSILGVLSXXXXXXXXX 61 QKTF++T + GIHARPAT LV TA+KY + + E GK V LKSI+GV+S Sbjct: 2 QKTFKVTADSGIHARPATVLVQTASKY-DADVNLEYNGKTVNLKSIMGVVSLGIAKGAEI 60 Query: 62 XXXXXXXXXXXXXXXXQEVMVKEGLGE 88 +E M EGLGE Sbjct: 61 TISASGADENDALNALEETMKSEGLGE 87 >pdb|2HPR| Histidine-Containing Phosphocarrier Protein Hpr Mutant With Met 51 Replaced By Val And Ser 83 Replaced By Cys (M51v, S83c) Length = 87 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 37/87 (42%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Query: 2 QKTFRITDEDGIHARPATTLVNTATKYKNTEAFAEARGKKVTLKSILGVLSXXXXXXXXX 61 QKTF++T + GIHARPAT LV TA+KY + + E GK V LKSI+GV+S Sbjct: 2 QKTFKVTADSGIHARPATVLVQTASKY-DADVNLEYNGKTVNLKSIMGVVSLGIAKGAEI 60 Query: 62 XXXXXXXXXXXXXXXXQEVMVKEGLGE 88 +E M EGLGE Sbjct: 61 TISASGADENDALNALEETMKCEGLGE 87 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.312 0.128 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 79,282,490 Number of extensions: 1687661 Number of successful extensions: 2881 Number of sequences better than 1.0e-05: 40 Number of HSP's gapped: 2854 Number of HSP's successfully gapped: 40 Length of query: 91 Length of database: 757,237,578 Length adjustment: 59 Effective length of query: 32 Effective length of database: 597,046,737 Effective search space: 19105495584 Effective search space used: 19105495584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)