BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0437.0029.p (122 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_471233.1| similar to unknown protein [Listeria innocua] >... 166 1e-40 emb|CAC19091.1| conserved hypothetical protein [Listeria innocua] 164 5e-40 ref|NP_833139.1| Transcriptional regulator, MarR family [Bacillu... 136 1e-31 ref|NP_653530.1| DUF24, Protein of unknown function DUF24 [Bacil... 136 2e-31 ref|NP_786389.1| transcription regulator (putative) [Lactobacill... 135 2e-31 >ref|NP_471233.1| similar to unknown protein [Listeria innocua] pir||AI1669 hypothetical protein homolog lin1899 [imported] - Listeria innocua (strain Clip11262) emb|CAC97129.1| lin1899 [Listeria innocua] Length = 120 Score = 166 bits (420), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 77/114 (67%), Positives = 92/114 (80%) Query: 1 MKQYHLGIEATLEIIGGKWKALIICLLMSGAKRTSELQRNIHGISQKVLIQQLRELEEDG 60 MK Y+LG+EATL+I+GGKWK LIIC L+ G KRT ELQR I ISQKVL+QQLRELE DG Sbjct: 1 MKVYNLGVEATLDIMGGKWKPLIICFLVQGTKRTGELQRCIPKISQKVLVQQLRELERDG 60 Query: 61 LVRRHVYQQMPPKVEYSLTEYGVTANKIVDIMCTWGKENIKMRQSQGEDIVLLE 114 ++ R VY ++PPKVEYS+T YG+T N IVD MC WGKENI +R SQGE + L+E Sbjct: 61 IIDRTVYNELPPKVEYSITAYGLTLNAIVDTMCQWGKENIALRNSQGEPVTLIE 114 >emb|CAC19091.1| conserved hypothetical protein [Listeria innocua] Length = 120 Score = 164 bits (416), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 76/114 (66%), Positives = 91/114 (79%) Query: 1 MKQYHLGIEATLEIIGGKWKALIICLLMSGAKRTSELQRNIHGISQKVLIQQLRELEEDG 60 MK Y+LG+EATL+I+GGKWK LIIC L G KRT ELQR I ISQKVL+QQLRELE DG Sbjct: 1 MKVYNLGVEATLDIMGGKWKPLIICFLAQGTKRTGELQRCIPKISQKVLVQQLRELERDG 60 Query: 61 LVRRHVYQQMPPKVEYSLTEYGVTANKIVDIMCTWGKENIKMRQSQGEDIVLLE 114 ++ R VY ++PPKVEYS+T YG++ N IVD MC WGKENI +R SQGE + L+E Sbjct: 61 IIDRTVYNELPPKVEYSITAYGLSLNAIVDTMCQWGKENIALRNSQGEPVTLIE 114 >ref|NP_833139.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP10340.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 115 Score = 136 bits (343), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 63/117 (53%), Positives = 90/117 (76%), Gaps = 2/117 (1%) Query: 1 MKQYHLGIEATLEIIGGKWKALIICLLMSGAKRTSELQRNIHGISQKVLIQQLRELEEDG 60 MK Y++ +EATLE+IGGKWK +I+C L G KRTSEL+R + GI+QK+L QQLRELEEDG Sbjct: 1 MKTYNIPVEATLEVIGGKWKVVILCHLKKGTKRTSELKRLMPGITQKMLTQQLRELEEDG 60 Query: 61 LVRRHVYQQMPPKVEYSLTEYGVTANKIVDIMCTWGKENIKMRQSQGEDIVLLEDES 117 +++R VY Q+PPKVEYSLT+YG + I+D +C+WG+ + + ++ +++ DES Sbjct: 61 VIQRKVYDQVPPKVEYSLTDYGSSLGAILDSLCSWGE--VHLEKTGNTSMLITADES 115 >ref|NP_653530.1| DUF24, Protein of unknown function DUF24 [Bacillus anthracis A2012] ref|NP_847487.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP28973.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 114 Score = 136 bits (342), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 60/96 (62%), Positives = 81/96 (84%) Query: 1 MKQYHLGIEATLEIIGGKWKALIICLLMSGAKRTSELQRNIHGISQKVLIQQLRELEEDG 60 MKQY++ +EATLE+IGGKWK +I+C L G KRTSEL+R++ GI+QK+L QQLRELE+DG Sbjct: 1 MKQYNIPVEATLEVIGGKWKVVILCHLTKGTKRTSELKRSMPGITQKMLTQQLRELEDDG 60 Query: 61 LVRRHVYQQMPPKVEYSLTEYGVTANKIVDIMCTWG 96 +++R VY Q+PPKVEYSLT+YG + I+D +C+WG Sbjct: 61 VIQRKVYNQVPPKVEYSLTDYGWSLESILDSLCSWG 96 >ref|NP_786389.1| transcription regulator (putative) [Lactobacillus plantarum WCFS1] emb|CAD65251.1| transcription regulator (putative) [Lactobacillus plantarum WCFS1] Length = 125 Score = 135 bits (341), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 62/112 (55%), Positives = 87/112 (77%) Query: 2 KQYHLGIEATLEIIGGKWKALIICLLMSGAKRTSELQRNIHGISQKVLIQQLRELEEDGL 61 K YH+G+EAT+EIIGGKWK++I+C L + RTSEL+R I ISQK+L+QQLRELE + Sbjct: 9 KTYHIGVEATMEIIGGKWKSIILCHLRTQTMRTSELERAIPQISQKMLVQQLRELEAANI 68 Query: 62 VRRHVYQQMPPKVEYSLTEYGVTANKIVDIMCTWGKENIKMRQSQGEDIVLL 113 V R VYQQ+PP+VEY L++YG + + ++ +C WG++NI R++ GE+I LL Sbjct: 69 VTRKVYQQVPPRVEYGLSDYGRSLSVVLHELCVWGEDNIDRRRAAGEEIALL 120 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 176,066,898 Number of extensions: 6064896 Number of successful extensions: 17288 Number of sequences better than 1.0e-05: 296 Number of HSP's gapped: 17236 Number of HSP's successfully gapped: 296 Length of query: 122 Length of database: 757,237,578 Length adjustment: 86 Effective length of query: 36 Effective length of database: 523,739,064 Effective search space: 18854606304 Effective search space used: 18854606304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)