BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0434.0026.p (198 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241703.1| BH0837~unknown conserved protein [Bacillus halo... 72 6e-12 ref|ZP_00183947.1| hypothetical protein Exigu058301 [Exiguobacte... 69 8e-11 ref|ZP_00072455.1| COG1670: Acetyltransferases, including N-acet... 67 2e-10 ref|NP_631692.1| putative acetyltransferase [Streptomyces coelic... 65 7e-10 ref|NP_623147.1| Acetyltransferases, including N-acetylases of r... 64 2e-09 >ref|NP_241703.1| BH0837~unknown conserved protein [Bacillus halodurans] pir||E83754 hypothetical protein BH0837 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04556.1| BH0837~unknown conserved protein [Bacillus halodurans] Length = 197 Score = 72.0 bits (175), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 48/173 (27%), Positives = 85/173 (49%), Gaps = 12/173 (6%) Query: 31 QGQKVELRTMPATESGVLKTLLAHPLVQPHILLR--QGASSPHAYLDKLAARMLHAVDPC 88 + +++ LR ++ + ++ V ++L Q A+L A L+ D Sbjct: 14 ETERLRLRKFYKDDAAAIYDYASNEQVTKYVLWETHQSIKDSEAFL----AFALNKYDEK 69 Query: 89 ALHAGIYALEQQE-LIGTVSLQNWNRYENKAVLGYLLNPLWWGRGLATEAVGLLLDYSFQ 147 + L++ E +IGTV W + A LGY+L+ +WG+G+ TEAV L+++ F Sbjct: 70 DVSPWAIELKRNERMIGTVDFVWWKPKDKTAELGYVLSEPYWGQGIMTEAVNALVEFGFN 129 Query: 148 ELGLLRAEGRCRGDNLRSERVMIKNGLTLE----RVLPMPGSPSDVMKVFTLL 196 + L R + +C +N+ S RVM K GL E R + + G+ D KV+ ++ Sbjct: 130 NMELERIQAKCFAENISSARVMEKAGLIYEGTHRRAIYVKGAHRD-FKVYAII 181 >ref|ZP_00183947.1| hypothetical protein Exigu058301 [Exiguobacterium sp. 255-15] Length = 201 Score = 68.6 bits (166), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 44/112 (39%), Positives = 69/112 (61%), Gaps = 9/112 (8%) Query: 95 YALEQQE---LIGTVSLQNWNRYENK-AVLGYLLNPLWWGRGLATEAVGLLLDYSFQELG 150 +A+E +E +IGT+ + ENK A LGY L+ +WG+G+ TEAV ++ + F+EL Sbjct: 74 WAIEWKETGKMIGTIDFIHLLLDENKQAELGYALSRQFWGKGIVTEAVECVMTFGFEELK 133 Query: 151 LLRAEGRCRGDNLRSERVMIKNGLTLE----RVLPMPGSPSDVMKVFTLLHN 198 L R + RC N+ S RVM K G+T E R++ + G+ DV K+++LL + Sbjct: 134 LERIQARCMEGNIGSARVMEKVGMTYEGTLRRLIFIKGAFHDV-KMYSLLRD 184 >ref|ZP_00072455.1| COG1670: Acetyltransferases, including N-acetylases of ribosomal proteins [Trichodesmium erythraeum IMS101] Length = 184 Score = 67.0 bits (162), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 5/101 (4%) Query: 100 QELIGTVSLQNWNRYENKAVLGYLLNPLWWGRGLATEAVGLLLDYSFQELGLLRAEGRCR 159 Q+ IGT +W ++A +GY L+ +WG+G TE V ++ + F+ + L R E RC Sbjct: 60 QKFIGTAGFIDWKIEHSRAEIGYTLSRKYWGKGYMTEVVNAIIYFGFRTMMLNRIEARCL 119 Query: 160 GDNLRSERVMIKNGLTLERVLP----MPGSPSDVMKVFTLL 196 +N+ S RVM K G+ E VL M G D +K++++L Sbjct: 120 IENIASARVMEKVGMKYEGVLRECIFMKGKYQD-LKIYSIL 159 >ref|NP_631692.1| putative acetyltransferase [Streptomyces coelicolor A3(2)] emb|CAC16985.1| putative acetyltransferase [Streptomyces coelicolor A3(2)] Length = 183 Score = 65.5 bits (158), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 50/126 (39%), Positives = 63/126 (50%), Gaps = 8/126 (6%) Query: 55 PLVQPHILLRQGASSPHAYLDKLAARMLHAVDPCALHAGIYALEQQE-LIGTVSLQNWNR 113 P V P + R A L++ AAR A D A +Y L +E L+G V ++ Sbjct: 36 PWVGPGFVTRD-TDGARATLERYAAR--QAADG----ARLYGLWSEEVLVGGVMFTQFDA 88 Query: 114 YENKAVLGYLLNPLWWGRGLATEAVGLLLDYSFQELGLLRAEGRCRGDNLRSERVMIKNG 173 +G L P GRGL T A GLLLD++F GL RAE CR DN RS V + G Sbjct: 89 AFGNCEIGCWLEPSAEGRGLITRACGLLLDWAFTVRGLHRAEWHCRADNDRSAAVAERLG 148 Query: 174 LTLERV 179 +TLE V Sbjct: 149 MTLEGV 154 >ref|NP_623147.1| Acetyltransferases, including N-acetylases of ribosomal proteins [Thermoanaerobacter tengcongensis] gb|AAM24751.1| Acetyltransferases, including N-acetylases of ribosomal proteins [Thermoanaerobacter tengcongensis] Length = 185 Score = 64.3 bits (155), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 5/108 (4%) Query: 93 GIYALEQQELIGTVSLQNWNRYENKAVLGYLLNPLWWGRGLATEAVGLLLDYSFQELGLL 152 G+Y E +LIGT + +GY+L +W +G+ TEAV ++++ F++L L Sbjct: 69 GLYLKENGKLIGTCGFLFIDEKNMVGEVGYVLGRKYWNKGIMTEAVRKVIEFGFEKLNLN 128 Query: 153 RAEGRCRGDNLRSERVMIKNGLTLERVLP----MPGSPSDVMKVFTLL 196 R + RC+ +N+ SERVM K G+ E VL + G D MK++++L Sbjct: 129 RIQARCKVENIASERVMQKVGMKFEGVLREAVFVKGRFWD-MKMYSIL 175 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 281,088,582 Number of extensions: 10882298 Number of successful extensions: 22272 Number of sequences better than 1.0e-05: 57 Number of HSP's gapped: 22315 Number of HSP's successfully gapped: 57 Length of query: 198 Length of database: 757,237,578 Length adjustment: 119 Effective length of query: 79 Effective length of database: 434,140,797 Effective search space: 34297122963 Effective search space used: 34297122963 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 123 (52.0 bits)