BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0434.0008.p (71 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243964.1| thioredoxin [Bacillus halodurans] >gi|25282738|... 98 7e-20 ref|NP_371669.1| thioredoxin [Staphylococcus aureus subsp. aureu... 88 5e-17 ref|NP_693038.1| thioredoxin [Oceanobacillus iheyensis HTE831] >... 88 7e-17 ref|NP_801543.1| putative thioredoxin [Streptococcus pyogenes SS... 87 1e-16 ref|NP_269836.1| putative thioredoxin [Streptococcus pyogenes] >... 87 2e-16 >ref|NP_243964.1| thioredoxin [Bacillus halodurans] pir||B84037 thioredoxin trxA [imported] - Bacillus halodurans (strain C-125) dbj|BAB06817.1| thioredoxin [Bacillus halodurans] Length = 104 Score = 97.8 bits (242), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 47/70 (67%), Positives = 56/70 (80%) Query: 1 MLAPILEELSTELGDDVKIAKLNVDENPETASRFGVMSIPTLIFFKDGQPVDKVVGLNSK 60 M+AP+LEEL E+GD VKIAKL+VDEN ETAS+F VMSIPTLI FKDGQ VD+V G K Sbjct: 34 MIAPVLEELDGEMGDKVKIAKLDVDENQETASKFNVMSIPTLIVFKDGQVVDQVTGFQPK 93 Query: 61 DSLKNIVAKH 70 D+L ++ KH Sbjct: 94 DALAELLNKH 103 >ref|NP_371669.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374262.1| thioredoxin [Staphylococcus aureus subsp. aureus N315] ref|NP_645845.1| thioredoxin [Staphylococcus aureus subsp. aureus MW2] sp|Q9ZEH4|THIO_STAAM Thioredoxin (TRX) pir||E89885 thioredoxin [imported] - Staphylococcus aureus (strain N315) emb|CAA11404.1| thioredoxin [Staphylococcus aureus] dbj|BAB42241.1| thioredoxin [Staphylococcus aureus subsp. aureus N315] dbj|BAB57307.1| thioredoxin [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94893.1| thioredoxin [Staphylococcus aureus subsp. aureus MW2] Length = 104 Score = 88.2 bits (217), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 41/70 (58%), Positives = 53/70 (75%) Query: 1 MLAPILEELSTELGDDVKIAKLNVDENPETASRFGVMSIPTLIFFKDGQPVDKVVGLNSK 60 M+AP+LEEL+ + I KL+VDENP TA+++ VMSIPTLI FKDGQPVDKVVG K Sbjct: 34 MIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPK 93 Query: 61 DSLKNIVAKH 70 ++L ++ KH Sbjct: 94 ENLAEVLDKH 103 >ref|NP_693038.1| thioredoxin [Oceanobacillus iheyensis HTE831] dbj|BAC14073.1| thioredoxin [Oceanobacillus iheyensis HTE831] Length = 104 Score = 87.8 bits (216), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 39/70 (55%), Positives = 56/70 (80%) Query: 1 MLAPILEELSTELGDDVKIAKLNVDENPETASRFGVMSIPTLIFFKDGQPVDKVVGLNSK 60 M+AP+LEE+ E+ + V+I KL+VDEN ETA +FGVMSIPTL+ FKDG VD+V+G K Sbjct: 34 MIAPVLEEIDGEMEEKVQIVKLDVDENQETAGKFGVMSIPTLLLFKDGDVVDQVIGFQPK 93 Query: 61 DSLKNIVAKH 70 ++L++++ KH Sbjct: 94 EALEDLINKH 103 >ref|NP_801543.1| putative thioredoxin [Streptococcus pyogenes SSI-1] dbj|BAC63376.1| putative thioredoxin [Streptococcus pyogenes SSI-1] Length = 110 Score = 87.0 bits (214), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 42/70 (60%), Positives = 58/70 (82%), Gaps = 1/70 (1%) Query: 1 MLAPILEELSTELGDD-VKIAKLNVDENPETASRFGVMSIPTLIFFKDGQPVDKVVGLNS 59 M APILE+LS E+ +D +KI K++VDENPETA +FG+MSIPTL+F KDG+ V +V G+++ Sbjct: 39 MQAPILEQLSQEIDEDELKILKMDVDENPETARQFGIMSIPTLMFKKDGEVVKQVAGVHT 98 Query: 60 KDSLKNIVAK 69 KD LK I+A+ Sbjct: 99 KDQLKAIIAE 108 >ref|NP_269836.1| putative thioredoxin [Streptococcus pyogenes] ref|NP_665390.1| putative thioredoxin [Streptococcus pyogenes MGAS315] ref|NP_688707.1| thioredoxin [Streptococcus agalactiae 2603V/R] ref|NP_736196.1| Unknown [Streptococcus agalactiae NEM316] gb|AAK34557.1| putative thioredoxin [Streptococcus pyogenes M1 GAS] gb|AAM80193.1| putative thioredoxin [Streptococcus pyogenes MGAS315] gb|AAN00580.1| thioredoxin [Streptococcus agalactiae 2603V/R] emb|CAD47421.1| Unknown [Streptococcus agalactiae NEM316] Length = 104 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 42/70 (60%), Positives = 58/70 (82%), Gaps = 1/70 (1%) Query: 1 MLAPILEELSTELGDD-VKIAKLNVDENPETASRFGVMSIPTLIFFKDGQPVDKVVGLNS 59 M APILE+LS E+ +D +KI K++VDENPETA +FG+MSIPTL+F KDG+ V +V G+++ Sbjct: 33 MQAPILEQLSQEIDEDELKILKMDVDENPETARQFGIMSIPTLMFKKDGEVVKQVAGVHT 92 Query: 60 KDSLKNIVAK 69 KD LK I+A+ Sbjct: 93 KDQLKAIIAE 102 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 103,634,242 Number of extensions: 3404098 Number of successful extensions: 8646 Number of sequences better than 1.0e-05: 645 Number of HSP's gapped: 8693 Number of HSP's successfully gapped: 646 Length of query: 71 Length of database: 757,237,578 Length adjustment: 42 Effective length of query: 29 Effective length of database: 643,203,420 Effective search space: 18652899180 Effective search space used: 18652899180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)