BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0427.0015.p (79 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_244286.1| nitrogen fixation protein (NifU protein) [Bacil... 86 3e-16 ref|ZP_00182096.1| hypothetical protein Exigu262501 [Exiguobacte... 84 9e-16 ref|NP_764185.1| nitrogen fixation protein NifU [Staphylococcus ... 82 3e-15 ref|NP_371460.1| hypothetical protein [Staphylococcus aureus sub... 81 8e-15 ref|NP_653418.1| NifU-like, NifU-like domain [Bacillus anthracis... 80 1e-14 >ref|NP_244286.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans] pir||C84077 nitrogen fixation protein (NifU protein) BH3419 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07138.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans] Length = 79 Score = 85.5 bits (210), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 43/79 (54%), Positives = 53/79 (67%) Query: 1 MEENGVLFDEVSEVLLKLRPFLLRDGGDAELVEVENGVAKLRFLGACNGCPSATITLKXX 60 ME + + ++V EVL KLRPFLLRDGGD ELV+VE+G+ K+R LGAC CPS+TITLK Sbjct: 1 METSTEMHEQVKEVLDKLRPFLLRDGGDVELVDVEDGIVKVRLLGACGSCPSSTITLKAG 60 Query: 61 XXXXXXXXXXXXKEVVQVF 79 KE+ QVF Sbjct: 61 IERALLEEVPGVKEIEQVF 79 >ref|ZP_00182096.1| hypothetical protein Exigu262501 [Exiguobacterium sp. 255-15] Length = 79 Score = 84.0 bits (206), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 38/52 (73%), Positives = 46/52 (88%) Query: 7 LFDEVSEVLLKLRPFLLRDGGDAELVEVENGVAKLRFLGACNGCPSATITLK 58 +FD+V+EVL KLRPFLLRDGGD ELV+VE+G+ KLR +GAC CPS+TITLK Sbjct: 7 MFDQVNEVLEKLRPFLLRDGGDVELVDVEDGIVKLRLMGACGSCPSSTITLK 58 >ref|NP_764185.1| nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC 12228] gb|AAO04227.1| nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC 12228] Length = 80 Score = 82.4 bits (202), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 41/77 (53%), Positives = 51/77 (66%) Query: 3 ENGVLFDEVSEVLLKLRPFLLRDGGDAELVEVENGVAKLRFLGACNGCPSATITLKXXXX 62 EN +FD+V+EV+ +LRPFLLRDGGD LV+VE+G+ KL+ GAC CPS+TITLK Sbjct: 4 ENPTMFDQVAEVIERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGIE 63 Query: 63 XXXXXXXXXXKEVVQVF 79 EV QVF Sbjct: 64 RALHEEVPGVIEVEQVF 80 >ref|NP_371460.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374058.1| hypothetical protein, similar to nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus N315] ref|NP_645635.1| ORFID:MW0818~hypothetical protein, similar to nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus MW2] pir||A89860 hypothetical protein SA0797 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42036.1| SA0797 [Staphylococcus aureus subsp. aureus N315] dbj|BAB57098.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB94683.1| MW0818 [Staphylococcus aureus subsp. aureus MW2] Length = 80 Score = 80.9 bits (198), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 39/77 (50%), Positives = 51/77 (66%) Query: 3 ENGVLFDEVSEVLLKLRPFLLRDGGDAELVEVENGVAKLRFLGACNGCPSATITLKXXXX 62 E+ +FD+V+EV+ +LRPFLLRDGGD L++VE+G+ KL+ GAC CPS+TITLK Sbjct: 4 EDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGIE 63 Query: 63 XXXXXXXXXXKEVVQVF 79 EV QVF Sbjct: 64 RALHEEVPGVIEVEQVF 80 >ref|NP_653418.1| NifU-like, NifU-like domain [Bacillus anthracis A2012] Length = 95 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 42/77 (54%), Positives = 50/77 (64%) Query: 3 ENGVLFDEVSEVLLKLRPFLLRDGGDAELVEVENGVAKLRFLGACNGCPSATITLKXXXX 62 EN + ++V EVL KLRPFLLRDGGD ELV++E G+ KLR +GAC CPS+TITLK Sbjct: 2 ENPHMQEQVLEVLDKLRPFLLRDGGDVELVDIEEGIVKLRLMGACGSCPSSTITLKAGIE 61 Query: 63 XXXXXXXXXXKEVVQVF 79 EV QVF Sbjct: 62 RALLEEVPGVIEVEQVF 78 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.141 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 85,923,920 Number of extensions: 2448950 Number of successful extensions: 5478 Number of sequences better than 1.0e-05: 206 Number of HSP's gapped: 5526 Number of HSP's successfully gapped: 206 Length of query: 79 Length of database: 757,237,578 Length adjustment: 49 Effective length of query: 30 Effective length of database: 624,197,727 Effective search space: 18725931810 Effective search space used: 18725931810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)