BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0420.0024.p (70 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of ... 71 8e-12 sp|P80579|THIO_ALIAC Thioredoxin (TRX) >gi|6980431|pdb|1QUW|A Ch... 71 9e-12 ref|ZP_00183156.1| hypothetical protein Exigu145401 [Exiguobacte... 70 1e-11 ref|NP_945429.1| thioredoxin [Rhodopseudomonas palustris CGA009]... 70 1e-11 pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of ... 70 2e-11 >pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NSW|B Chain B, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NSW|C Chain C, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NSW|D Chain D, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 Score = 70.9 bits (172), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 46/68 (67%) Query: 1 MFAPVLEEFEKEANDSIKVVKVNVDENPVTSSLFQIMSIPATIIFKDGKPLYKELGILPK 60 M APVLEEF + D + V K+NVDENP T+S F IMSIP I+FK G+P+ + +G PK Sbjct: 34 MMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPK 93 Query: 61 GALQQLVA 68 L+ +A Sbjct: 94 EQLEAQLA 101 >sp|P80579|THIO_ALIAC Thioredoxin (TRX) pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 Score = 70.9 bits (172), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 46/68 (67%) Query: 1 MFAPVLEEFEKEANDSIKVVKVNVDENPVTSSLFQIMSIPATIIFKDGKPLYKELGILPK 60 M APVLEEF + D + V K+NVDENP T+S F IMSIP I+FK G+P+ + +G PK Sbjct: 34 MMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPK 93 Query: 61 GALQQLVA 68 L+ +A Sbjct: 94 EQLEAQLA 101 >ref|ZP_00183156.1| hypothetical protein Exigu145401 [Exiguobacterium sp. 255-15] Length = 70 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Query: 1 MFAPVLEEFEKEANDSIKVVKVNVDENPVTSSLFQIMSIPATIIFKDGKPLYKELGILPK 60 M APVLEE + + +++K+VKV+VD NP + FQ+ SIP ++FKDG+P+ K +G +PK Sbjct: 1 MLAPVLEELDADM-ENVKIVKVDVDANPEVAGAFQVQSIPTLVLFKDGQPVNKTMGFMPK 59 Query: 61 GALQQLVAS 69 AL++ V + Sbjct: 60 DALKEFVET 68 >ref|NP_945429.1| thioredoxin [Rhodopseudomonas palustris CGA009] emb|CAE25517.1| thioredoxin [Rhodopseudomonas palustris] Length = 106 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/69 (44%), Positives = 47/69 (68%) Query: 1 MFAPVLEEFEKEANDSIKVVKVNVDENPVTSSLFQIMSIPATIIFKDGKPLYKELGILPK 60 M AP L+E D +K+VK+NVDE+PVT+S + +MSIP +IFK G+ +++G PK Sbjct: 36 MIAPALDEIAGAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPK 95 Query: 61 GALQQLVAS 69 LQQ +++ Sbjct: 96 AKLQQWISA 104 >pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|B Chain B, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|C Chain C, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|D Chain D, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|E Chain E, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|F Chain F, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|G Chain G, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius pdb|1NW2|H Chain H, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 Score = 70.1 bits (170), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 46/68 (67%) Query: 1 MFAPVLEEFEKEANDSIKVVKVNVDENPVTSSLFQIMSIPATIIFKDGKPLYKELGILPK 60 M APVLEEF + D + V K+NVDENP T+S F IMSIP I+FK G+P+ + +G PK Sbjct: 34 MMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPK 93 Query: 61 GALQQLVA 68 L+ +A Sbjct: 94 EQLEAQLA 101 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.135 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 96,580,243 Number of extensions: 3133289 Number of successful extensions: 11335 Number of sequences better than 1.0e-05: 304 Number of HSP's gapped: 11352 Number of HSP's successfully gapped: 305 Length of query: 70 Length of database: 757,237,578 Length adjustment: 41 Effective length of query: 29 Effective length of database: 645,918,519 Effective search space: 18731637051 Effective search space used: 18731637051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)