BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0420.0009.p (78 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_623104.1| Small, acid-soluble spore proteins, alpha/be [T... 77 1e-13 ref|NP_623103.1| Small, acid-soluble spore proteins, alpha/be [T... 74 1e-12 ref|NP_654798.1| SASP, Small, acid-soluble spore proteins, alpha... 69 3e-11 ref|NP_981076.1| small, acid-soluble spore protein B [Bacillus c... 68 7e-11 ref|NP_658678.1| SASP, Small, acid-soluble spore proteins, alpha... 68 7e-11 >ref|NP_623104.1| Small, acid-soluble spore proteins, alpha/be [Thermoanaerobacter tengcongensis] gb|AAM24708.1| Small, acid-soluble spore proteins, alpha/be [Thermoanaerobacter tengcongensis] Length = 75 Score = 77.4 bits (189), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 48/63 (76%) Query: 14 NNLVVPQATAALQQLKYEAAQELGVTIPADGYYGNYTSRETGSLGGYITKRLVQLAEQQL 73 N LVV +A + Q KYE A+ELG+ PADGY+GN TSR+ G++GG++ ++++Q+AE QL Sbjct: 9 NPLVVKEAKQIMNQWKYEVARELGINPPADGYWGNLTSRDCGAVGGHMVRKMIQMAESQL 68 Query: 74 SGR 76 + + Sbjct: 69 ASK 71 >ref|NP_623103.1| Small, acid-soluble spore proteins, alpha/be [Thermoanaerobacter tengcongensis] gb|AAM24707.1| Small, acid-soluble spore proteins, alpha/be [Thermoanaerobacter tengcongensis] Length = 75 Score = 73.9 bits (180), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 30/63 (47%), Positives = 47/63 (74%) Query: 14 NNLVVPQATAALQQLKYEAAQELGVTIPADGYYGNYTSRETGSLGGYITKRLVQLAEQQL 73 N LVV +A + Q KYE A ELG+T PADGY+G TSR+ G++GG++ ++++Q+AE Q+ Sbjct: 9 NPLVVKEARQVMNQWKYEIANELGITPPADGYWGYLTSRDCGAVGGHMVRKMIQMAESQM 68 Query: 74 SGR 76 + + Sbjct: 69 ASK 71 >ref|NP_654798.1| SASP, Small, acid-soluble spore proteins, alpha/beta type [Bacillus anthracis A2012] ref|NP_830661.1| Small acid-soluble spore protein [Bacillus cereus ATCC 14579] ref|NP_843371.1| small acid-soluble spore protein [Bacillus anthracis str. Ames] ref|NP_977271.1| small acid-soluble spore protein [Bacillus cereus ATCC 10987] gb|AAP07862.1| Small acid-soluble spore protein [Bacillus cereus ATCC 14579] gb|AAP24857.1| small acid-soluble spore protein [Bacillus anthracis str. Ames] gb|AAS39879.1| small acid-soluble spore protein [Bacillus cereus ATCC 10987] Length = 67 Score = 69.3 bits (168), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 43/62 (69%), Gaps = 5/62 (8%) Query: 14 NNLVVPQATAALQQLKYEAAQELGVTIPADGYYGNYTSRETGSLGGYITKRLVQLAEQQL 73 N LVVP ATAA+ Q+KYE AQE GV + AD T+R GS+GG ITKRLV +AEQ L Sbjct: 8 NQLVVPGATAAIDQMKYEIAQEFGVQLGAD-----STARANGSVGGEITKRLVAMAEQSL 62 Query: 74 SG 75 G Sbjct: 63 GG 64 >ref|NP_981076.1| small, acid-soluble spore protein B [Bacillus cereus ATCC 10987] gb|AAS43684.1| small, acid-soluble spore protein B [Bacillus cereus ATCC 10987] Length = 65 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Query: 14 NNLVVPQATAALQQLKYEAAQELGVTIPADGYYGNYTSRETGSLGGYITKRLVQLAEQQL 73 N L VP A +AL Q+KYE AQE GV + AD T+R GS+GG ITKRLV LAEQQL Sbjct: 6 NKLAVPGAESALDQMKYEIAQEFGVQLGADA-----TARANGSVGGEITKRLVSLAEQQL 60 Query: 74 SG 75 G Sbjct: 61 GG 62 >ref|NP_658678.1| SASP, Small, acid-soluble spore proteins, alpha/beta type [Bacillus anthracis A2012] ref|NP_847097.1| small, acid-soluble spore protein B [Bacillus anthracis str. Ames] gb|AAP28583.1| small, acid-soluble spore protein B [Bacillus anthracis str. Ames] Length = 65 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Query: 14 NNLVVPQATAALQQLKYEAAQELGVTIPADGYYGNYTSRETGSLGGYITKRLVQLAEQQL 73 N L VP A +AL Q+KYE AQE GV + AD T+R GS+GG ITKRLV LAEQQL Sbjct: 6 NKLAVPGAESALDQMKYEIAQEFGVQLGADA-----TARANGSVGGEITKRLVSLAEQQL 60 Query: 74 SG 75 G Sbjct: 61 GG 62 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.311 0.128 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 89,971,154 Number of extensions: 2765664 Number of successful extensions: 17520 Number of sequences better than 1.0e-05: 47 Number of HSP's gapped: 17489 Number of HSP's successfully gapped: 47 Length of query: 78 Length of database: 757,237,578 Length adjustment: 48 Effective length of query: 30 Effective length of database: 626,912,826 Effective search space: 18807384780 Effective search space used: 18807384780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)