BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0417.0018.p (81 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_390576.1| similar to spore coat protein [Bacillus subtili... 108 3e-23 ref|NP_347251.1| Spore coat protein F [Clostridium acetobutylicu... 99 3e-20 ref|NP_390573.1| similar to spore coat protein [Bacillus subtili... 74 1e-12 ref|NP_241609.1| spore coat protein [Bacillus halodurans] >gi|25... 71 7e-12 ref|NP_656983.1| hypothetical protein predicted by GeneMark [Bac... 68 7e-11 >ref|NP_390576.1| similar to spore coat protein [Bacillus subtilis] pir||D69970 spore coat protein homolog yraD - Bacillus subtilis emb|CAA63470.1| spore coat protein F [Bacillus subtilis] emb|CAB14640.1| yraD [Bacillus subtilis subsp. subtilis str. 168] Length = 99 Score = 108 bits (271), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 44/81 (54%), Positives = 69/81 (85%) Query: 1 VIAMDFLMNAKSGVRNYAMAVTECATPEIKQILMKQLDEAIDSHEKITIYIMQRGLYHPY 60 +IAMD L++AK+GVRNYAMA TE TPE+K++L++ L+EA+D HE+++ Y+M++G YHP+ Sbjct: 18 IIAMDLLISAKNGVRNYAMAATEAGTPEVKEVLIRHLEEALDMHEQLSSYMMEKGWYHPW 77 Query: 61 HIPEQIQLDLKNIQTAMNIPS 81 + EQ++L+LKNI TA+ +P+ Sbjct: 78 NPDEQVKLNLKNIDTAIQLPT 98 >ref|NP_347251.1| Spore coat protein F [Clostridium acetobutylicum] pir||D96975 spore coat protein F [imported] - Clostridium acetobutylicum gb|AAK78591.1| Spore coat protein F [Clostridium acetobutylicum] Length = 98 Score = 99.4 bits (246), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 42/79 (53%), Positives = 61/79 (77%) Query: 1 VIAMDFLMNAKSGVRNYAMAVTECATPEIKQILMKQLDEAIDSHEKITIYIMQRGLYHPY 60 V+A DFL++ KSGV+NYA+A+TE ATP ++ IL K LDE I+ HEKI Y+M G YHPY Sbjct: 18 VVATDFLISTKSGVKNYAVAITETATPRVRAILRKHLDEGINCHEKILNYMMTNGYYHPY 77 Query: 61 HIPEQIQLDLKNIQTAMNI 79 ++ EQ + D+K+ +T++N+ Sbjct: 78 NMQEQYKTDMKSTETSLNL 96 >ref|NP_390573.1| similar to spore coat protein [Bacillus subtilis] pir||F69970 spore coat protein homolog yraF - Bacillus subtilis gb|AAB80875.1| hypothetical spore coat protein [Bacillus subtilis] emb|CAA63473.1| spore coat protein F [Bacillus subtilis] emb|CAB14637.1| yraF [Bacillus subtilis subsp. subtilis str. 168] Length = 122 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 49/69 (71%) Query: 1 VIAMDFLMNAKSGVRNYAMAVTECATPEIKQILMKQLDEAIDSHEKITIYIMQRGLYHPY 60 AMDFL+ AK GVRN A+A+TE A+P+++ +L KQL + I H++IT ++ + +HPY Sbjct: 21 TFAMDFLIRAKEGVRNTAVALTETASPDVRALLRKQLMQGIAMHQEITELMISKKWFHPY 80 Query: 61 HIPEQIQLD 69 + EQ +LD Sbjct: 81 ELSEQYKLD 89 >ref|NP_241609.1| spore coat protein [Bacillus halodurans] pir||G83742 spore coat protein BH0743 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04462.1| spore coat protein [Bacillus halodurans] Length = 105 Score = 71.2 bits (173), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 35/78 (44%), Positives = 57/78 (73%) Query: 1 VIAMDFLMNAKSGVRNYAMAVTECATPEIKQILMKQLDEAIDSHEKITIYIMQRGLYHPY 60 V+A D L+ AK+G++N A A++E ATPE++ L +QLD+ I H ++T Y+M+ G YHPY Sbjct: 18 VVATDMLIAAKAGIKNIATAISESATPEVRAALQQQLDQQIRFHGQMTEYMMKNGYYHPY 77 Query: 61 HIPEQIQLDLKNIQTAMN 78 ++ EQ+++DL TA++ Sbjct: 78 NMEEQVRVDLAAANTALS 95 >ref|NP_656983.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_845445.1| spore coat protein F [Bacillus anthracis str. Ames] gb|AAP26931.1| spore coat protein F [Bacillus anthracis str. Ames] Length = 159 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 30/77 (38%), Positives = 53/77 (68%) Query: 3 AMDFLMNAKSGVRNYAMAVTECATPEIKQILMKQLDEAIDSHEKITIYIMQRGLYHPYHI 62 A D L AK+ VRNYA+A+TE ATP ++++L +Q++ AI H ++ ++ +RG Y Y + Sbjct: 81 AGDLLGLAKTSVRNYAIAITETATPRLREVLTRQINGAIQLHAQVFNFMYERGYYPAYDL 140 Query: 63 PEQIQLDLKNIQTAMNI 79 E ++ D++N+Q A+ + Sbjct: 141 KELLKNDVQNVQKAIQM 157 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 103,746,409 Number of extensions: 3011604 Number of successful extensions: 8019 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 8019 Number of HSP's successfully gapped: 6 Length of query: 81 Length of database: 757,237,578 Length adjustment: 51 Effective length of query: 30 Effective length of database: 618,767,529 Effective search space: 18563025870 Effective search space used: 18563025870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)