BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0405.0008.p (144 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00184078.1| hypothetical protein Exigu049201 [Exiguobacte... 129 2e-29 ref|NP_391881.1| similar to transcriptional regulator (MarR fami... 122 2e-27 ref|NP_824479.1| putative MarR-family transcriptional regulator ... 93 2e-18 ref|NP_629113.1| putative marR-family transcriptional regulator ... 90 2e-17 ref|NP_602121.1| transcriptional regulator [Corynebacterium glut... 77 8e-14 >ref|ZP_00184078.1| hypothetical protein Exigu049201 [Exiguobacterium sp. 255-15] Length = 140 Score = 129 bits (325), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 67/139 (48%), Positives = 94/139 (67%), Gaps = 2/139 (1%) Query: 2 NNTVDVIELEMAILVRRLVSMTTYKKIGNLDRSAYLLLYQIDSHGSAGVKALSDEFHLDI 61 N +++ IELE+AIL+RRL + T + NLDR++YLLL Q+ G GVK L+ E LD+ Sbjct: 3 NKSLETIELELAILIRRLTTATADNR--NLDRASYLLLRQLLHSGQVGVKTLARELQLDV 60 Query: 62 STVSRQAAALEQKGYVRRIPDPVDGRAYSLEMTEAGLEVLNENKKARQDSIGKMLSSWSD 121 STVSRQAAAL+QK V +I DP DGRA+ +T+ G + L + AR SI ++L++W D Sbjct: 61 STVSRQAAALDQKKLVEKIKDPTDGRAFFYNITDYGQQELEIYRTARLTSIERLLTNWPD 120 Query: 122 GERVIFGELLRKFNMAILE 140 + FG LL++FN A+ E Sbjct: 121 EDTESFGRLLKQFNQALRE 139 >ref|NP_391881.1| similar to transcriptional regulator (MarR family) [Bacillus subtilis] sp|P42103|YXAD_BACSU Putative HTH-type transcriptional regulator yxaD pir||D70071 transcription regulator MarR family homolog yxaD - Bacillus subtilis dbj|BAA21583.1| probable transcriptional regulator [Bacillus subtilis] emb|CAB16038.1| yxaD [Bacillus subtilis subsp. subtilis str. 168] Length = 143 Score = 122 bits (307), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 62/140 (44%), Positives = 91/140 (65%), Gaps = 1/140 (0%) Query: 2 NNTVDVIELEMAILVRRLVSM-TTYKKIGNLDRSAYLLLYQIDSHGSAGVKALSDEFHLD 60 N V++IE E+ +RR V + + K+ GNL+RS+YLLL Q+D G A VK L++ F LD Sbjct: 4 QNPVELIEYELTTFIRRAVYLDQSEKRTGNLERSSYLLLRQLDEFGPARVKELAESFKLD 63 Query: 61 ISTVSRQAAALEQKGYVRRIPDPVDGRAYSLEMTEAGLEVLNENKKARQDSIGKMLSSWS 120 IST+SRQAAALE K + R DP DGR +T+ G ++L +++ R + +ML WS Sbjct: 64 ISTLSRQAAALEAKELIYRFSDPSDGRVSLFTITKLGKQLLKADQQKRLERYEQMLKEWS 123 Query: 121 DGERVIFGELLRKFNMAILE 140 E+ +FGELL++ N A ++ Sbjct: 124 TQEKEMFGELLQRMNKAFID 143 >ref|NP_824479.1| putative MarR-family transcriptional regulator [Streptomyces avermitilis MA-4680] dbj|BAC71014.1| putative MarR-family transcriptional regulator [Streptomyces avermitilis MA-4680] Length = 166 Score = 93.2 bits (230), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 51/138 (36%), Positives = 79/138 (57%), Gaps = 5/138 (3%) Query: 5 VDVIELEMAILVRRLVSMTTYKKIG----NLDRSAYLLLYQIDSHGSAGVKALSDEFHLD 60 +D ++ E+A+ RR T +G ++DR+AYLLL ++D G GVKAL+ +D Sbjct: 12 LDTLQHEVAVFARR-AEQTRLGGVGQVRNSMDRAAYLLLNRLDKEGPMGVKALAASMGID 70 Query: 61 ISTVSRQAAALEQKGYVRRIPDPVDGRAYSLEMTEAGLEVLNENKKARQDSIGKMLSSWS 120 STV+RQ A L G V+R P DGRA L+++ G+ L E + +R+ + ++ W+ Sbjct: 71 SSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLSPRGMSRLEEVRSSRRQLMSELTHDWA 130 Query: 121 DGERVIFGELLRKFNMAI 138 ER F LL +FN A+ Sbjct: 131 PQEREAFTALLTRFNTAL 148 >ref|NP_629113.1| putative marR-family transcriptional regulator [Streptomyces coelicolor A3(2)] emb|CAD30947.1| putative marR-family transcriptional regulator [Streptomyces coelicolor A3(2)] Length = 166 Score = 89.7 bits (221), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 5/138 (3%) Query: 5 VDVIELEMAILVRRLVSMTTYKKIG----NLDRSAYLLLYQIDSHGSAGVKALSDEFHLD 60 ++ ++ E+A+ RR T +G ++DR+AYLLL ++D G GVKAL+ +D Sbjct: 12 LETLQHEVALFARR-AEQTRLGGVGQVRNSMDRAAYLLLNRLDKEGPMGVKALAASMGID 70 Query: 61 ISTVSRQAAALEQKGYVRRIPDPVDGRAYSLEMTEAGLEVLNENKKARQDSIGKMLSSWS 120 STV+RQ A L G V+R P DGRA L+++ G+ L E + +R+ + ++ W+ Sbjct: 71 SSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLSPRGVARLEEVRSSRRQLMAELTHDWA 130 Query: 121 DGERVIFGELLRKFNMAI 138 ER F LL +FN A+ Sbjct: 131 PQERETFCALLARFNGAL 148 >ref|NP_602121.1| transcriptional regulator [Corynebacterium glutamicum ATCC 13032] dbj|BAC00328.1| Transcriptional regulators [Corynebacterium glutamicum ATCC 13032] emb|CAF20958.1| Bacterial regulatory protein, MarR family [Corynebacterium glutamicum ATCC 13032] Length = 152 Score = 77.4 bits (189), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 49/138 (35%), Positives = 69/138 (50%), Gaps = 2/138 (1%) Query: 3 NTVDVIELEMAILVRRLVSMTTY--KKIGNLDRSAYLLLYQIDSHGSAGVKALSDEFHLD 60 + + +E E I R T G LD S Y LL + G + + LS LD Sbjct: 4 DPIAALEYESTIFARHRNQYTGQAGTNAGVLDSSGYNLLTLLQLRGPSTIGELSAITGLD 63 Query: 61 ISTVSRQAAALEQKGYVRRIPDPVDGRAYSLEMTEAGLEVLNENKKARQDSIGKMLSSWS 120 ST++RQ AL KG+V RIPDP G A T+ G E+LNE + + Q+ ++LS W Sbjct: 64 ASTLNRQTKALLTKGFVERIPDPDGGIARKFHPTDLGNELLNEERTSSQEKYAELLSDWP 123 Query: 121 DGERVIFGELLRKFNMAI 138 + + F +LL K N A+ Sbjct: 124 EEDLRTFVKLLEKLNKAV 141 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.133 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 191,495,276 Number of extensions: 6659333 Number of successful extensions: 19886 Number of sequences better than 1.0e-05: 21 Number of HSP's gapped: 19905 Number of HSP's successfully gapped: 21 Length of query: 144 Length of database: 757,237,578 Length adjustment: 104 Effective length of query: 40 Effective length of database: 474,867,282 Effective search space: 18994691280 Effective search space used: 18994691280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)