BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0402.0034.p (76 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_781466.1| two-component response regulator [Clostridium t... 97 1e-19 ref|NP_830149.1| Two-component response regulator [Bacillus cere... 96 2e-19 ref|NP_976622.1| DNA-binding response regulator [Bacillus cereus... 96 2e-19 ref|NP_842823.1| DNA-binding response regulator [Bacillus anthra... 96 3e-19 ref|NP_878013.1| vancomycin response regulator VanR [Staphylococ... 88 6e-17 >ref|NP_781466.1| two-component response regulator [Clostridium tetani E88] gb|AAO35403.1| two-component response regulator [Clostridium tetani E88] Length = 233 Score = 97.1 bits (240), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 43/74 (58%), Positives = 58/74 (78%) Query: 1 MTPKEYGILLLLARNKGRVFTSRDIYELVWEDTYLESDNTVLTHIRNLREKLGDTVKNSK 60 +TP+E+ IL LLARNKG VF+ IYE VW++ + +SDNTV+ HIR LREK+ + + K Sbjct: 159 LTPREFDILELLARNKGIVFSIEKIYERVWKEEFFKSDNTVMVHIRKLREKIEENPRKPK 218 Query: 61 YIRTVWGVGYKVDK 74 Y++TVWGVGYKV+K Sbjct: 219 YVKTVWGVGYKVEK 232 >ref|NP_830149.1| Two-component response regulator [Bacillus cereus ATCC 14579] gb|AAP07350.1| Two-component response regulator [Bacillus cereus ATCC 14579] Length = 233 Score = 95.9 bits (237), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 58/76 (76%) Query: 1 MTPKEYGILLLLARNKGRVFTSRDIYELVWEDTYLESDNTVLTHIRNLREKLGDTVKNSK 60 +TP+E+ IL LLARN G VF++ IYE VW + +SDNTV+ HIR +REK+ + + + Sbjct: 158 LTPREFSILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPR 217 Query: 61 YIRTVWGVGYKVDKEV 76 YI+TVWGVGYK++K++ Sbjct: 218 YIKTVWGVGYKIEKDI 233 >ref|NP_976622.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] gb|AAS39230.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] Length = 233 Score = 95.9 bits (237), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 58/76 (76%) Query: 1 MTPKEYGILLLLARNKGRVFTSRDIYELVWEDTYLESDNTVLTHIRNLREKLGDTVKNSK 60 +TP+E+ IL LLARN G VF++ IYE VW + +SDNTV+ HIR +REK+ + + + Sbjct: 158 LTPREFSILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPR 217 Query: 61 YIRTVWGVGYKVDKEV 76 YI+TVWGVGYK++K++ Sbjct: 218 YIKTVWGVGYKIEKDI 233 >ref|NP_842823.1| DNA-binding response regulator [Bacillus anthracis str. Ames] gb|AAP24309.1| DNA-binding response regulator [Bacillus anthracis str. Ames] Length = 233 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 58/76 (76%) Query: 1 MTPKEYGILLLLARNKGRVFTSRDIYELVWEDTYLESDNTVLTHIRNLREKLGDTVKNSK 60 +TP+E+ IL LLARN G VF++ IYE VW + +SDNTV+ HIR +REK+ + + + Sbjct: 158 LTPREFSILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPR 217 Query: 61 YIRTVWGVGYKVDKEV 76 YI+TVWGVGYK++K++ Sbjct: 218 YIKTVWGVGYKIEKDI 233 >ref|NP_878013.1| vancomycin response regulator VanR [Staphylococcus aureus] sp|Q06239|VANR_ENTFC Regulatory protein vanR pir||A41838 transcription activator VanR - Enterococcus faecium gb|AAA24787.1| vancomycin response regulator gb|AAA24790.1| vanR gb|AAA65953.1| vanR [Enterococcus faecium] gb|AAM77882.1| cytoplasmic regulator [Enterococcus faecium] gb|AAQ17157.1| vancomycin response regulator VanR [Staphylococcus aureus] prf||1904198A vanR gene Length = 231 Score = 88.2 bits (217), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 39/75 (52%), Positives = 55/75 (73%), Gaps = 1/75 (1%) Query: 1 MTPKEYGILLLLARNKGRVFTSRDIYELVWEDTYL-ESDNTVLTHIRNLREKLGDTVKNS 59 +TP E+ IL +L NKG V +S ++ +W D Y +S+NT+ HIR+LREK+ DT+ N Sbjct: 157 LTPTEFSILRILCENKGNVVSSELLFHEIWGDEYFSKSNNTITVHIRHLREKMNDTIDNP 216 Query: 60 KYIRTVWGVGYKVDK 74 KYI+TVWGVGYK++K Sbjct: 217 KYIKTVWGVGYKIEK 231 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 119,925,981 Number of extensions: 4019612 Number of successful extensions: 13944 Number of sequences better than 1.0e-05: 448 Number of HSP's gapped: 14332 Number of HSP's successfully gapped: 448 Length of query: 76 Length of database: 757,237,578 Length adjustment: 46 Effective length of query: 30 Effective length of database: 632,343,024 Effective search space: 18970290720 Effective search space used: 18970290720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)