BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0402.0033.p (157 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_622667.1| Response regulators consisting of a CheY-like r... 120 8e-27 ref|ZP_00036365.1| COG0745: Response regulators consisting of a ... 120 8e-27 ref|NP_816885.1| DNA-binding response regulator [Enterococcus fa... 120 1e-26 ref|ZP_00018883.1| hypothetical protein [Chloroflexus aurantiacus] 118 3e-26 ref|NP_978356.1| DNA-binding response regulator [Bacillus cereus... 117 1e-25 >ref|NP_622667.1| Response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain [Thermoanaerobacter tengcongensis] gb|AAM24271.1| Response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain [Thermoanaerobacter tengcongensis] Length = 229 Score = 120 bits (302), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 57/120 (47%), Positives = 81/120 (67%) Query: 1 MCTRILIVDDDRTIVDFLSIFLEREGYSISSCYDGVTALDYIRAEAFQLILLDIMMPAMN 60 M +ILIV+D+R I FL + E EGY + YDG + + + L+LLDIM+P M+ Sbjct: 1 MKEKILIVEDERQIARFLQLEFEHEGYEVKIVYDGTSGVKEALEGDYDLVLLDIMLPGMD 60 Query: 61 GFDLISRIREISEIPVIFLTAKDQQEDKIRGFIAGCDDYVTKPFDLTELSLRISAILKRR 120 G++++ +IRE S+IPVI LTAK + +DK+RG G DDYVTKPF + EL R+ A L++R Sbjct: 61 GYEVLKKIRENSDIPVIMLTAKYEVKDKVRGLDIGADDYVTKPFSIEELFARVRAALRKR 120 >ref|ZP_00036365.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Enterococcus faecium] Length = 236 Score = 120 bits (301), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 57/117 (48%), Positives = 80/117 (68%), Gaps = 1/117 (0%) Query: 4 RILIVDDDRTIVDFLSIFLEREGYSISSCYDGVTALDYIRA-EAFQLILLDIMMPAMNGF 62 +ILI DDD+ IV+ LSI++ EGY YDG AL IR +L++LDIMMP M+G Sbjct: 9 KILIADDDKEIVELLSIYVHNEGYEAVKAYDGKEALSKIRTIPDIELLILDIMMPEMDGM 68 Query: 63 DLISRIREISEIPVIFLTAKDQQEDKIRGFIAGCDDYVTKPFDLTELSLRISAILKR 119 ++ +R+ S+IP+I LTAK DKI+G +AG DDYVTKPF+ E+ R+ ++L+R Sbjct: 69 QVVKELRKESQIPIIMLTAKTTDMDKIKGLVAGADDYVTKPFNPLEVMARVKSLLRR 125 >ref|NP_816885.1| DNA-binding response regulator [Enterococcus faecalis V583] gb|AAO82955.1| DNA-binding response regulator [Enterococcus faecalis V583] gb|AAS49401.1| response regulator [Enterococcus faecalis] Length = 229 Score = 120 bits (300), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 1/117 (0%) Query: 4 RILIVDDDRTIVDFLSIFLEREGYSISSCYDGVTALDYIRAEA-FQLILLDIMMPAMNGF 62 +IL+ DDD+ IV+ LSI++ EGY + YDG AL + L++LDIMMP M+G Sbjct: 2 KILVADDDKEIVELLSIYIHNEGYEVVKAYDGKEALSKLHTTPDIDLLILDIMMPIMDGM 61 Query: 63 DLISRIREISEIPVIFLTAKDQQEDKIRGFIAGCDDYVTKPFDLTELSLRISAILKR 119 +++ +R+ S+IP+I LTAK DKI+G +AG DDYVTKPF+ E+ R+ +IL+R Sbjct: 62 EVVKELRKESQIPIIMLTAKTTDMDKIKGLVAGADDYVTKPFNPLEVMARVKSILRR 118 >ref|ZP_00018883.1| hypothetical protein [Chloroflexus aurantiacus] Length = 246 Score = 118 bits (296), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 54/115 (46%), Positives = 81/115 (70%) Query: 5 ILIVDDDRTIVDFLSIFLEREGYSISSCYDGVTALDYIRAEAFQLILLDIMMPAMNGFDL 64 +L+VDD+ ++ F+ + LE EG +++ +G A++ +R E ++LLDIMMP M+GF+ Sbjct: 9 VLVVDDEPRMITFMRMNLELEGMRVTTATNGREAVEKVREEMPDIVLLDIMMPVMDGFEA 68 Query: 65 ISRIREISEIPVIFLTAKDQQEDKIRGFIAGCDDYVTKPFDLTELSLRISAILKR 119 + RIR S++PVI LTAKD++ED++RG G DDYV KPF EL RI A+L+R Sbjct: 69 LRRIRSFSQVPVIILTAKDEEEDRVRGLELGADDYVGKPFSQRELVSRIRAVLRR 123 >ref|NP_978356.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] gb|AAS40964.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] Length = 225 Score = 117 bits (292), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 56/119 (47%), Positives = 79/119 (66%) Query: 1 MCTRILIVDDDRTIVDFLSIFLEREGYSISSCYDGVTALDYIRAEAFQLILLDIMMPAMN 60 M +ILIVDDD I + +S+FLEREG+ DG+ AL I +++LDIMMP M+ Sbjct: 1 MLPKILIVDDDPHIRELVSVFLEREGFQTYEAIDGLDALQKINEVKVDMVILDIMMPNMD 60 Query: 61 GFDLISRIREISEIPVIFLTAKDQQEDKIRGFIAGCDDYVTKPFDLTELSLRISAILKR 119 GFD+ +R+ +IP++ LTAK + K++GF G DDY+ KPFD EL +R+ A+LKR Sbjct: 61 GFDVCFELRKYYDIPILMLTAKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKR 119 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.327 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 174,688,360 Number of extensions: 5747885 Number of successful extensions: 31356 Number of sequences better than 1.0e-05: 5485 Number of HSP's gapped: 28876 Number of HSP's successfully gapped: 5550 Length of query: 157 Length of database: 757,237,578 Length adjustment: 115 Effective length of query: 42 Effective length of database: 445,001,193 Effective search space: 18690050106 Effective search space used: 18690050106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)