BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0402.0013.p (227 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_562420.1| conserved hypothetical protein [Clostridium per... 71 2e-11 ref|ZP_00180345.1| hypothetical protein Mther168401 [Moorella th... 71 2e-11 ref|NP_843212.1| conserved hypothetical protein [Bacillus anthra... 69 1e-10 ref|NP_780955.1| hypothetical membrane associated protein [Clost... 67 3e-10 ref|NP_657678.1| SH3b, Bacterial SH3 domain homologues [Bacillus... 67 3e-10 >ref|NP_562420.1| conserved hypothetical protein [Clostridium perfringens] dbj|BAB81210.1| conserved hypothetical protein [Clostridium perfringens str. 13] Length = 337 Score = 71.2 bits (173), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 47/143 (32%), Positives = 76/143 (53%), Gaps = 17/143 (11%) Query: 86 QALASVEPAAKASGEASLLSVEPQTNTVQAWGKEYSYDRVLQVKATAYSS--AASENGKW 143 Q L EP K ++ +T T+ G+ ++ + L VK+TAY+ ++E Sbjct: 209 QELVVKEPVNK-----EVVKGTKETQTLSRGGESINFKKKLSVKSTAYNHPLGSAEAYTA 263 Query: 144 GAVDYFGNPLKLGTIAVDPSVIPLGTKVLVTGYSHPGLPKQAFIATATDMGSAIKGNRID 203 + +P TIAVDPSVIPLGTK+ V GY + A A D G AIKGNR+D Sbjct: 264 SGMHVLRDPNGYSTIAVDPSVIPLGTKLYVEGYGY---------AIAADTGGAIKGNRVD 314 Query: 204 IFIPGSQSYVADFGFQYVQLYMI 226 +F +++ +++G + + +Y++ Sbjct: 315 LFF-NTEAEASNWGVRNLDVYIL 336 >ref|ZP_00180345.1| hypothetical protein Mther168401 [Moorella thermoacetica ATCC 39073] Length = 333 Score = 70.9 bits (172), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 17/111 (15%) Query: 117 GKEYSYDRVLQVKATAYSSAASENGKWGAVDYFGNPLKLGTIAVDPSVIPLGTKVLVTGY 176 G+ + ++RV ATAY+ + GA G ++GTIAVDP+V+PLGT++ V GY Sbjct: 240 GQSFRFERVFWATATAYTHS-------GAPTATGAYPRVGTIAVDPAVVPLGTRLYVEGY 292 Query: 177 SHPGLPKQAFIATATDMGSAIKGNRIDIFIPGSQSYVADFGFQYVQLYMIE 227 + A D+GSAIKG+RID+F+ +++ +G + V++Y++ Sbjct: 293 GY---------GIAQDIGSAIKGDRIDVFL-DTEADTRRWGVRRVKVYVLR 333 >ref|NP_843212.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP24698.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 420 Score = 68.6 bits (166), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 45/113 (39%), Positives = 63/113 (55%), Gaps = 22/113 (19%) Query: 124 RVLQVKATAYSSAASENG---------KWGAVDYFGNP-LKLGTIAVDPSVIPLGTKVLV 173 R + V ATAY++ +ENG WG + NP +KL IAVDPSVIPLG++V V Sbjct: 319 REIYVHATAYTADPAENGYGPGQQVYSAWGGYNLTANPGMKL--IAVDPSVIPLGSRVYV 376 Query: 174 TGYSHPGLPKQAFIATATDMGSAIKGNRIDIFIPGSQSYVADFGFQYVQLYMI 226 GY A A D G AIKG++ID+ +P S + +G + V+L ++ Sbjct: 377 EGYGE---------AIAADTGGAIKGHKIDVLMPDKASS-SKWGRKNVKLTIL 419 >ref|NP_780955.1| hypothetical membrane associated protein [Clostridium tetani E88] gb|AAO34892.1| hypothetical membrane associated protein [Clostridium tetani E88] Length = 368 Score = 67.4 bits (163), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 45/123 (36%), Positives = 65/123 (52%), Gaps = 20/123 (16%) Query: 115 AWGKEYSYDRVLQVKATAYSSAASENGKWGAVDYFG----------NPLKLGTIAVDPSV 164 + G + Y ++++ATAY+S GK FG + TIAVDP V Sbjct: 256 SRGGNFQYANAMKMRATAYTSDYESTGKNPGDPGFGITATGTVAKRSQGGYSTIAVDPRV 315 Query: 165 IPLGTKVLVTGYSHPGLPKQAFIATATDMGSAIKGNRIDIFIPGSQSYVADFGFQYVQLY 224 IPLGTKV V GY + A A D G AIKGNRID+++ S S ++G ++V +Y Sbjct: 316 IPLGTKVYVEGYGY---------AIAEDTGGAIKGNRIDVYL-SSNSEANNWGVKWVNVY 365 Query: 225 MIE 227 +++ Sbjct: 366 ILK 368 >ref|NP_657678.1| SH3b, Bacterial SH3 domain homologues [Bacillus anthracis A2012] Length = 310 Score = 67.0 bits (162), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 44/111 (39%), Positives = 59/111 (53%), Gaps = 18/111 (16%) Query: 124 RVLQVKATAYSSAASENGKWGAV-------DYFGNPLKLGTIAVDPSVIPLGTKVLVTGY 176 R + V+ATAY++ SENG +G D NP + IAVDP V+PLG+KV V GY Sbjct: 211 REITVEATAYTAHPSENGTYGGRVLTAMGHDLTANP-NMKVIAVDPKVMPLGSKVWVEGY 269 Query: 177 SHPGLPKQAFIATATDMGSAIKGNRIDIFIPGSQSYVADFGFQYVQLYMIE 227 A A D G IKGN ID+ + GS +G + V++ +IE Sbjct: 270 GE---------AIAGDTGGXIKGNXIDVLV-GSDGSXNSWGRKSVKVKVIE 310 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 279,203,898 Number of extensions: 9933411 Number of successful extensions: 22666 Number of sequences better than 1.0e-05: 44 Number of HSP's gapped: 22633 Number of HSP's successfully gapped: 44 Length of query: 227 Length of database: 757,237,578 Length adjustment: 121 Effective length of query: 106 Effective length of database: 428,710,599 Effective search space: 45443323494 Effective search space used: 45443323494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 124 (52.4 bits)