BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0391.0040.p
         (86 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_693177.1| cytochrome aa3 quinol oxidase subunit IV [Ocean...    60   2e-08

>ref|NP_693177.1| cytochrome aa3 quinol oxidase subunit IV [Oceanobacillus
          iheyensis HTE831]
 dbj|BAC14212.1| cytochrome aa3 quinol oxidase subunit IV [Oceanobacillus
          iheyensis HTE831]
          Length = 94

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 20 DLSKGANMAVLLVTAIIQASLQLFVFMHIGEAADTKKELYINIAYALFVGLVTIFGTLYI 79
          D+S    + +L+VTA IQA +QL VFMH GE+ D K  +Y +I Y   + L+T+FG+L  
Sbjct: 30 DMSFAMGLTILIVTAFIQAGVQLIVFMHAGESED-KGTIYTSIYYGALIALLTVFGSLLA 88

Query: 80 FVWGW 84
           VWG+
Sbjct: 89 MVWGY 93


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.330    0.144    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 87,800,310
Number of extensions: 2512059
Number of successful extensions: 9035
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 9038
Number of HSP's successfully gapped: 1
Length of query: 86
Length of database: 757,237,578
Length adjustment: 55
Effective length of query: 31
Effective length of database: 607,907,133
Effective search space: 18845121123
Effective search space used: 18845121123
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 120 (50.8 bits)