BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0388.0001.p (111 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAK00997.1| unknown [environmental sequence] 58 7e-08 ref|NP_457498.1| L-asparaginase [Salmonella enterica subsp. ente... 56 3e-07 pdb|4ECA|A Chain A, Asparaginase From E. Coli, Mutant T89v With ... 55 4e-07 pdb|1HO3|A Chain A, Crystal Structure Analysis Of E. Coli L-Aspa... 55 4e-07 pdb|1IHD|A Chain A, Crystal Structure Of Trigonal Form Of D90e M... 55 4e-07 >gb|EAK00997.1| unknown [environmental sequence] Length = 142 Score = 57.8 bits (138), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Query: 37 KPWIDKVGELKNNDIPVVRCSRISSGITLKDSYIDLSA-NSIPCNSLVPQKARILLSLAL 95 K D + + VVR SR+ +G T +D+ +D + + SL PQKAR+LL LAL Sbjct: 67 KTIFDTLATAAHKGTVVVRSSRVPTGATTQDAEVDDAKYGFVASGSLNPQKARVLLQLAL 126 Query: 96 TQTTGYEEIAAMFNEY 111 TQT ++I MFN+Y Sbjct: 127 TQTKDPKQIQEMFNQY 142 >ref|NP_457498.1| L-asparaginase [Salmonella enterica subsp. enterica serovar Typhi] ref|NP_462022.1| periplasmic L-asparaginase II [Salmonella typhimurium LT2] ref|NP_806710.1| L-asparaginase [Salmonella enterica subsp. enterica serovar Typhi Ty2] pir||AB0879 asparaginase (EC 3.5.1.1) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gb|AAL21981.1| periplasmic L-asparaginase II [Salmonella typhimurium LT2] emb|CAD02930.1| L-asparaginase [Salmonella enterica subsp. enterica serovar Typhi] gb|AAO70570.1| L-asparaginase [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 348 Score = 55.8 bits (133), Expect = 3e-07, Method: Composition-based stats. Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Query: 37 KPWIDKVGELKNNDIPVVRCSRISSGITLKDSYIDLSANS-IPCNSLVPQKARILLSLAL 95 K D + +N VVR SR+ +G T +D+ +D + + +L PQKAR+LL LAL Sbjct: 273 KTVFDTLATAAHNGTVVVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLAL 332 Query: 96 TQTTGYEEIAAMFNEY 111 TQT ++I MFN+Y Sbjct: 333 TQTKDPKQIQTMFNQY 348 >pdb|4ECA|A Chain A, Asparaginase From E. Coli, Mutant T89v With Covalently Bound Aspartate pdb|4ECA|B Chain B, Asparaginase From E. Coli, Mutant T89v With Covalently Bound Aspartate pdb|4ECA|C Chain C, Asparaginase From E. Coli, Mutant T89v With Covalently Bound Aspartate pdb|4ECA|D Chain D, Asparaginase From E. Coli, Mutant T89v With Covalently Bound Aspartate Length = 326 Score = 55.5 bits (132), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 53 VVRCSRISSGITLKDSYIDLSA-NSIPCNSLVPQKARILLSLALTQTTGYEEIAAMFNEY 111 VVR SR+ +G T +D+ +D + + +L PQKAR+LL LALTQT ++I +FN+Y Sbjct: 267 VVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY 326 >pdb|1HO3|A Chain A, Crystal Structure Analysis Of E. Coli L-Asparaginase Ii (Y25f Mutant) pdb|1HO3|B Chain B, Crystal Structure Analysis Of E. Coli L-Asparaginase Ii (Y25f Mutant) Length = 326 Score = 55.5 bits (132), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 53 VVRCSRISSGITLKDSYIDLSA-NSIPCNSLVPQKARILLSLALTQTTGYEEIAAMFNEY 111 VVR SR+ +G T +D+ +D + + +L PQKAR+LL LALTQT ++I +FN+Y Sbjct: 267 VVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY 326 >pdb|1IHD|A Chain A, Crystal Structure Of Trigonal Form Of D90e Mutant Of Escherichia Coli Asparaginase Ii pdb|1IHD|C Chain C, Crystal Structure Of Trigonal Form Of D90e Mutant Of Escherichia Coli Asparaginase Ii pdb|1JAZ|A Chain A, Crystal Structure Of Monoclinic Form Of D90e Mutant Of Escherichia Coli Asparaginase Ii pdb|1JAZ|B Chain B, Crystal Structure Of Monoclinic Form Of D90e Mutant Of Escherichia Coli Asparaginase Ii pdb|1JJA|A Chain A, Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii pdb|1JJA|B Chain B, Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii pdb|1JJA|C Chain C, Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii pdb|1JJA|D Chain D, Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii pdb|1JJA|E Chain E, Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii pdb|1JJA|F Chain F, Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii Length = 326 Score = 55.5 bits (132), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 53 VVRCSRISSGITLKDSYIDLSA-NSIPCNSLVPQKARILLSLALTQTTGYEEIAAMFNEY 111 VVR SR+ +G T +D+ +D + + +L PQKAR+LL LALTQT ++I +FN+Y Sbjct: 267 VVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY 326 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 140,561,760 Number of extensions: 4417925 Number of successful extensions: 8043 Number of sequences better than 1.0e-05: 14 Number of HSP's gapped: 8051 Number of HSP's successfully gapped: 14 Length of query: 111 Length of database: 757,237,578 Length adjustment: 77 Effective length of query: 34 Effective length of database: 548,174,955 Effective search space: 18637948470 Effective search space used: 18637948470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)