BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0382.0019.p (128 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_785745.1| transcription regulator [Lactobacillus plantaru... 99 3e-20 ref|NP_786333.1| transcription regulator [Lactobacillus plantaru... 99 4e-20 ref|ZP_00156027.1| COG0789: Predicted transcriptional regulators... 96 2e-19 ref|NP_691706.1| transcriptional regulator [Oceanobacillus iheye... 95 4e-19 ref|NP_465003.1| similar to transcriptional regulator (MerR fami... 94 8e-19 >ref|NP_785745.1| transcription regulator [Lactobacillus plantarum WCFS1] emb|CAD64596.1| transcription regulator [Lactobacillus plantarum WCFS1] Length = 153 Score = 99.0 bits (245), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 47/123 (38%), Positives = 75/123 (60%) Query: 3 YSIKTIAQKSGLSQYTLRYYEREGVLPVVARDEHGNRCFHDEDLELISLICCLKDTGMPI 62 YSI +A+K+G+S YTLRYY++ G+ P V RD+ G R F+DEDL+ ++LI CLK TGMP+ Sbjct: 2 YSIGAVAKKTGISSYTLRYYDKAGLTPFVKRDKQGRRVFNDEDLDSLALIRCLKQTGMPL 61 Query: 63 AEIKQFIALSREGVEALPDQRKLLQAHKLQIDEKIKFFQSFAQKIEHKIAYFASLEREAQ 122 +I+QFI+ +G + + + + + ++ +I QK+ HKI + + Sbjct: 62 EDIRQFISWCADGDGTIDQRLAMFEEQRQAVEAQIHQSLLNLQKVNHKIDVYRRASQAGS 121 Query: 123 ERA 125 E A Sbjct: 122 EAA 124 >ref|NP_786333.1| transcription regulator [Lactobacillus plantarum WCFS1] emb|CAD65193.1| transcription regulator [Lactobacillus plantarum WCFS1] Length = 147 Score = 98.6 bits (244), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 43/90 (47%), Positives = 64/90 (71%) Query: 1 MGYSIKTIAQKSGLSQYTLRYYEREGVLPVVARDEHGNRCFHDEDLELISLICCLKDTGM 60 M Y+IK +A K GLS YTLR+Y+++G+LP V+R+E G R F D DL L+ I CLK+TGM Sbjct: 1 MTYTIKEVADKVGLSAYTLRFYDKQGLLPFVSRNESGYRAFTDGDLHLLHTIICLKNTGM 60 Query: 61 PIAEIKQFIALSREGVEALPDQRKLLQAHK 90 I+ I+Q+I+ G +++ +R+LL H+ Sbjct: 61 AISAIRQYISYVMAGPQSIAQRRELLTTHR 90 >ref|ZP_00156027.1| COG0789: Predicted transcriptional regulators [Haemophilus influenzae R2866] Length = 135 Score = 95.9 bits (237), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 43/114 (37%), Positives = 75/114 (65%) Query: 1 MGYSIKTIAQKSGLSQYTLRYYEREGVLPVVARDEHGNRCFHDEDLELISLICCLKDTGM 60 M Y+ A+K+G+S YTLR+Y++EG+LP V RDE+GNR F D+DL+ +SL+ CLK+TGM Sbjct: 1 MTYTTAKAAEKTGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLSLLQCLKNTGM 60 Query: 61 PIAEIKQFIALSREGVEALPDQRKLLQAHKLQIDEKIKFFQSFAQKIEHKIAYF 114 + +IK+F + G + + ++ L + + +I + + +E+K+A++ Sbjct: 61 SLKDIKRFAECTIIGDDTIEERLSLFENQTKNVKCQIAELKRYLDLLEYKLAFY 114 >ref|NP_691706.1| transcriptional regulator [Oceanobacillus iheyensis HTE831] dbj|BAC12741.1| transcriptional regulator [Oceanobacillus iheyensis HTE831] Length = 138 Score = 95.1 bits (235), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 47/114 (41%), Positives = 66/114 (57%) Query: 3 YSIKTIAQKSGLSQYTLRYYEREGVLPVVARDEHGNRCFHDEDLELISLICCLKDTGMPI 62 YSI +A K L+ YTLRYY++EG+LP V R ++G R F D D+E + +I CLK TGMPI Sbjct: 4 YSISEVANKLNLTVYTLRYYDKEGLLPFVERKDNGTRLFKDADIEALHIIECLKSTGMPI 63 Query: 63 AEIKQFIALSREGVEALPDQRKLLQAHKLQIDEKIKFFQSFAQKIEHKIAYFAS 116 EIK FI EG L + L K ++ +++ I+HK Y+ + Sbjct: 64 KEIKNFIDWCGEGDATLQQRYDLFVERKANVEAQLEELTKTMAIIDHKCDYYKT 117 >ref|NP_465003.1| similar to transcriptional regulator (MerR family) [Listeria monocytogenes EGD-e] pir||AF1259 transcription regulator (MerR family) homolog lmo1478 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99556.1| lmo1478 [Listeria monocytogenes] Length = 145 Score = 94.4 bits (233), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 44/116 (37%), Positives = 77/116 (66%) Query: 1 MGYSIKTIAQKSGLSQYTLRYYEREGVLPVVARDEHGNRCFHDEDLELISLICCLKDTGM 60 M YSIK +++ LS YTLRYY+++G+LP V++++ G R F + DL LI ICCLK+TGM Sbjct: 1 MTYSIKEVSKIFNLSIYTLRYYDKQGLLPFVSKNQSGYREFTESDLNLIHTICCLKNTGM 60 Query: 61 PIAEIKQFIALSREGVEALPDQRKLLQAHKLQIDEKIKFFQSFAQKIEHKIAYFAS 116 P+ +I+ +I EG ++ +++LL H+ + + ++ ++++ KIA ++S Sbjct: 61 PLKQIRTYIDYCMEGPVSIEARKQLLLDHRAAVLKSLEDLTENLKEVDVKIAKYSS 116 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 170,302,823 Number of extensions: 6176950 Number of successful extensions: 17835 Number of sequences better than 1.0e-05: 128 Number of HSP's gapped: 17903 Number of HSP's successfully gapped: 128 Length of query: 128 Length of database: 757,237,578 Length adjustment: 91 Effective length of query: 37 Effective length of database: 510,163,569 Effective search space: 18876052053 Effective search space used: 18876052053 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)