BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0382.0001.p (113 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00013569.1| COG2076: Membrane transporters of cations and... 108 4e-23 ref|NP_391237.1| similar to multidrug-efflux transporter [Bacill... 107 7e-23 ref|NP_979612.1| multidrug resistance protein, Smr family [Bacil... 103 1e-21 ref|NP_657212.1| DUF7, Integral membrane protein DUF7 [Bacillus ... 101 7e-21 ref|NP_350248.1| Membrane transporters of cations and cationic d... 100 8e-21 >ref|ZP_00013569.1| COG2076: Membrane transporters of cations and cationic drugs [Rhodospirillum rubrum] Length = 173 Score = 108 bits (270), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 56/106 (52%), Positives = 76/106 (71%) Query: 6 AWAWVFLVLAILFELSGTISMKISHGFTRLWPSVLMFLFYGISFTSLNVALTSIKVGVAY 65 A W+ L AILFEL+GT +MK+S GFTRL PSV + + Y ISFT L + L + V +AY Sbjct: 67 AMTWLTLTGAILFELAGTTAMKLSEGFTRLLPSVALVVCYAISFTLLTLTLKKMDVSIAY 126 Query: 66 AVWSGAGIILISLVGALYFGERMTLSSLLWVTVIVAGIVGLNISAK 111 A+WSGAG +LI+++G L F E TL +L + +IVAG+VGLN+ +K Sbjct: 127 AIWSGAGTVLITVIGILVFKEPATLLKVLCIALIVAGVVGLNLLSK 172 >ref|NP_391237.1| similar to multidrug-efflux transporter [Bacillus subtilis] sp|O32227|YVAE_BACSU Hypothetical protein yvaE pir||C70027 multidrug-efflux transporter homolog yvaE - Bacillus subtilis emb|CAB15362.1| yvaE [Bacillus subtilis subsp. subtilis str. 168] Length = 119 Score = 107 bits (268), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 55/100 (55%), Positives = 77/100 (77%) Query: 9 WVFLVLAILFELSGTISMKISHGFTRLWPSVLMFLFYGISFTSLNVALTSIKVGVAYAVW 68 WVFL LAILFE++GT+SMK+S GFT+L PS+L+ FYG S L + L SI V VAYAVW Sbjct: 3 WVFLCLAILFEVAGTVSMKLSSGFTKLIPSLLLIFFYGGSLFFLTLTLKSIDVSVAYAVW 62 Query: 69 SGAGIILISLVGALYFGERMTLSSLLWVTVIVAGIVGLNI 108 SG GI+LI++VG L+F E +++ ++ + +I+AG+V LN+ Sbjct: 63 SGMGIVLITVVGFLFFQEHVSVMKVISIGLIIAGVVSLNL 102 >ref|NP_979612.1| multidrug resistance protein, Smr family [Bacillus cereus ATCC 10987] gb|AAS42220.1| multidrug resistance protein, Smr family [Bacillus cereus ATCC 10987] Length = 120 Score = 103 bits (256), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 49/106 (46%), Positives = 76/106 (71%) Query: 8 AWVFLVLAILFELSGTISMKISHGFTRLWPSVLMFLFYGISFTSLNVALTSIKVGVAYAV 67 W++L AILFE++GT +MK+S G T+L PS+L+F+FY +SF L+ AL +++ VAYAV Sbjct: 2 QWIYLCFAILFEVAGTTAMKLSDGLTKLVPSILIFVFYVVSFAFLSFALKGMEMSVAYAV 61 Query: 68 WSGAGIILISLVGALYFGERMTLSSLLWVTVIVAGIVGLNISAKGH 113 WSG GI+ I+ +G +YFGE + + +L + I+ G+V LN ++ H Sbjct: 62 WSGMGIVTITTIGFIYFGESINIIKILAILFILVGVVILNFNSTAH 107 >ref|NP_657212.1| DUF7, Integral membrane protein DUF7 [Bacillus anthracis A2012] ref|NP_845639.1| multidrug resistance protein, Smr family [Bacillus anthracis str. Ames] gb|AAP27125.1| multidrug resistance protein, Smr family [Bacillus anthracis str. Ames] Length = 120 Score = 101 bits (251), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 48/105 (45%), Positives = 77/105 (73%) Query: 9 WVFLVLAILFELSGTISMKISHGFTRLWPSVLMFLFYGISFTSLNVALTSIKVGVAYAVW 68 W++L LAILFE++GT ++K+S G T+L PS+L+F+FY +SF L+ AL +++ VAYAVW Sbjct: 3 WIYLCLAILFEVAGTTAIKLSDGLTKLVPSILIFVFYVVSFAFLSFALKGMEMSVAYAVW 62 Query: 69 SGAGIILISLVGALYFGERMTLSSLLWVTVIVAGIVGLNISAKGH 113 SG GI+ I+ +G +YFGE + + ++ + I+ G+V LN ++ H Sbjct: 63 SGMGIVTITTIGFIYFGESINIIKIVAILFILIGVVILNFNSTAH 107 >ref|NP_350248.1| Membrane transporters of cations and cationic drugs [Clostridium acetobutylicum] pir||A97350 membrane transporters of cations and cationic drugs CAC3666 [imported] - Clostridium acetobutylicum gb|AAK81588.1| Membrane transporters of cations and cationic drugs [Clostridium acetobutylicum] Length = 107 Score = 100 bits (250), Expect = 8e-21, Method: Compositional matrix adjust. Identities = 48/106 (45%), Positives = 76/106 (71%) Query: 8 AWVFLVLAILFELSGTISMKISHGFTRLWPSVLMFLFYGISFTSLNVALTSIKVGVAYAV 67 +W++L+LAI+FE+SGT MK S GF+ +++M +FY +S + L +AL I +GVAYA+ Sbjct: 2 SWIYLILAIIFEVSGTTFMKQSKGFSDFKYAIVMMVFYILSLSMLTLALKKIDIGVAYAI 61 Query: 68 WSGAGIILISLVGALYFGERMTLSSLLWVTVIVAGIVGLNISAKGH 113 WS GI+LI +G L F E + +S +L + +I+ G+VGLN+++K H Sbjct: 62 WSAVGIVLIVTIGILVFKEPVNISKILCILLIIVGVVGLNLTSKVH 107 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.329 0.140 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 156,126,772 Number of extensions: 5436579 Number of successful extensions: 27655 Number of sequences better than 1.0e-05: 562 Number of HSP's gapped: 27622 Number of HSP's successfully gapped: 562 Length of query: 113 Length of database: 757,237,578 Length adjustment: 78 Effective length of query: 35 Effective length of database: 545,459,856 Effective search space: 19091094960 Effective search space used: 19091094960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 120 (50.8 bits)