BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0368.0023.p (176 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243895.1| cell-shape determining protein [Bacillus halodu... 63 3e-09 ref|NP_390679.1| cell-shape determining protein [Bacillus subtil... 60 3e-08 pir||JC4596 cell shape determinant MreD - Bacillus stearothermop... 59 3e-08 ref|NP_692972.1| cell-shape determining protein [Oceanobacillus ... 54 1e-06 >ref|NP_243895.1| cell-shape determining protein [Bacillus halodurans] pir||E84028 cell-shape determining protein mreD [imported] - Bacillus halodurans (strain C-125) dbj|BAB06748.1| cell-shape determining protein [Bacillus halodurans] Length = 174 Score = 62.8 bits (151), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 40/158 (25%), Positives = 81/158 (51%), Gaps = 3/158 (1%) Query: 19 EGTIMPWLLPN--AWEMRIIPNLVFIVILFVTVYHHRHTALILGLTFGMLHDVVFYGRIL 76 EGT+ ++ A E+ I+P + ++++F+ +Y R + + GL FG+L DVV Y ++ Sbjct: 17 EGTLFQLVITERFASEIMIVPRFLIVMLVFIGIYLGRWSGALYGLIFGLLFDVV-YTDLI 75 Query: 77 GAHSFAMGVSAYLIGLIFQLPRAPLPLMMTVVLLGSLLEDSVLFAIYSVFNLSRVSYDWA 136 G + F + Y L ++ + +T+ L L + + + + L+ + + Sbjct: 76 GVYMFGFALLGYGFALTYKWLQYSNLTQVTLAFLAVFLFEYYQYGLLQIIGLTEMDHTMF 135 Query: 137 LLHHMLPTMLFHFAVALLLYVPLRKQIEQLKKETRKEE 174 H +LPT+ + A A+L+ +P+RK ++ + K R E Sbjct: 136 FQHRLLPTLALNGAFAILMVLPMRKLLQYVLKMARFRE 173 >ref|NP_390679.1| cell-shape determining protein [Bacillus subtilis] sp|Q01467|MRED_BACSU Rod shape-determining protein mreD pir||E45239 cell shape determinant mreD - Bacillus subtilis gb|AAA22399.1| MreD protein gb|AAA22607.1| putative emb|CAB14761.1| cell-shape determining protein [Bacillus subtilis subsp. subtilis str. 168] Length = 172 Score = 59.7 bits (143), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 38/137 (27%), Positives = 73/137 (53%), Gaps = 1/137 (0%) Query: 37 PNLVFIVILFVTVYHHRHTALILGLTFGMLHDVVFYGRILGAHSFAMGVSAYLIGLIFQL 96 P + +V++F++ + ++ A+I G FG L+D+ Y +LG + F YL F++ Sbjct: 37 PRFLMLVLIFMSAFINQKHAMIYGFIFGFLYDMN-YTSLLGVYMFGFAGLCYLASKAFKV 95 Query: 97 PRAPLPLMMTVVLLGSLLEDSVLFAIYSVFNLSRVSYDWALLHHMLPTMLFHFAVALLLY 156 +++ + +L L + +F I S+ + ++++ +L +PT+L + A AL+L Sbjct: 96 LHTNAFVVILIAVLAVCLLEFYVFGIQSLIHKDIMTFNGFVLDRFIPTILLNIAAALILV 155 Query: 157 VPLRKQIEQLKKETRKE 173 +P R LKKE R E Sbjct: 156 LPFRLFFMSLKKELRDE 172 >pir||JC4596 cell shape determinant MreD - Bacillus stearothermophilus prf||2207195B mreD gene Length = 172 Score = 59.3 bits (142), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 38/137 (27%), Positives = 73/137 (53%), Gaps = 1/137 (0%) Query: 37 PNLVFIVILFVTVYHHRHTALILGLTFGMLHDVVFYGRILGAHSFAMGVSAYLIGLIFQL 96 P + +V++F++ + ++ A+I G FG L+D+ Y +LG + F YL F++ Sbjct: 37 PRFLMLVLIFMSAFINQKHAMIYGFIFGFLYDMN-YTSLLGVYMFGFAGLCYLASKAFKV 95 Query: 97 PRAPLPLMMTVVLLGSLLEDSVLFAIYSVFNLSRVSYDWALLHHMLPTMLFHFAVALLLY 156 +++ + +L L + +F I S+ + ++++ +L +PT+L + A AL+L Sbjct: 96 LHTNAFVVILIAVLAVCLLEFYVFGIQSLIHKDIMTFNGFVLDRFIPTILLNIAAALILV 155 Query: 157 VPLRKQIEQLKKETRKE 173 +P R LKKE R E Sbjct: 156 LPFRLFFMSLKKELRDE 172 >ref|NP_692972.1| cell-shape determining protein [Oceanobacillus iheyensis HTE831] dbj|BAC14007.1| cell-shape determining protein [Oceanobacillus iheyensis HTE831] Length = 180 Score = 54.3 bits (129), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 36/138 (26%), Positives = 80/138 (57%), Gaps = 4/138 (2%) Query: 35 IIPNLVFIVILFVTVY-HHRHT--ALILGLTFGMLHDVVFYGRILGAHSFAMGVSAYLIG 91 I+P+ +FI ++FV V+ H T +++ L FG+L D+V+ G +LG + F+ + Y++ Sbjct: 36 IVPHWLFIFLVFVAVFFDHNDTYYSVLYALIFGLLFDIVYTG-VLGVYMFSYALVIYIVH 94 Query: 92 LIFQLPRAPLPLMMTVVLLGSLLEDSVLFAIYSVFNLSRVSYDWALLHHMLPTMLFHFAV 151 I ++ + +++ + G +L + ++ I+SV + +S + +L+ + PT+L + Sbjct: 95 GIKKMLQGNFYVLLLLATFGIVLIEFTIYGIFSVVGMVDISIESFMLNRLAPTILLNLVF 154 Query: 152 ALLLYVPLRKQIEQLKKE 169 +++Y K++E+ K E Sbjct: 155 LIVIYPFSSKRLEKWKTE 172 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.332 0.144 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 232,599,065 Number of extensions: 9088176 Number of successful extensions: 41619 Number of sequences better than 1.0e-05: 11 Number of HSP's gapped: 41612 Number of HSP's successfully gapped: 11 Length of query: 176 Length of database: 757,237,578 Length adjustment: 117 Effective length of query: 59 Effective length of database: 439,570,995 Effective search space: 25934688705 Effective search space used: 25934688705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 121 (51.2 bits)