BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0359.0008.p (188 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP79640.1| NreC [Staphylococcus carnosus] 238 7e-62 ref|NP_372915.1| hypothetical protein [Staphylococcus aureus sub... 232 4e-60 ref|NP_765524.1| response regulators of two-component regulatory... 231 9e-60 gb|AAD10462.1| orfx; function unknown; similar to response regul... 182 3e-45 ref|NP_785095.1| response regulator [Lactobacillus plantarum WCF... 140 2e-32 >gb|AAP79640.1| NreC [Staphylococcus carnosus] Length = 217 Score = 238 bits (606), Expect = 7e-62, Method: Compositional matrix adjust. Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 2/159 (1%) Query: 8 MKIVIADDHAMVRSGFSMILNFQDDIEVIGAAADGIEAYAMVAKRRPDILIMDLSMPPGE 67 MKIVIADDHA+VR+GFSMILNFQDD+EV+ AADG+EAY V + +PD+LIMDLSMPPGE Sbjct: 1 MKIVIADDHAVVRTGFSMILNFQDDMEVVDTAADGVEAYQKVMQHQPDVLIMDLSMPPGE 60 Query: 68 SGLIATGKIKEDYPDTKILILTMHDDEEYLFHVLKNGASGYVLKSAPDEELLLAIRTIYE 127 SGLIAT KI E +PDTKILILTM+DDEEYLFHVL+NGA GY+LK+APDE+L+ A+RT+Y Sbjct: 61 SGLIATSKIVESFPDTKILILTMYDDEEYLFHVLRNGAKGYILKNAPDEQLISAVRTVYR 120 Query: 128 GGTYIHPKMATSLVREFIKK--DKTASTEDLFELLSKRE 164 G TYI PKM TSLV EF+ ST D F +LSKRE Sbjct: 121 GDTYIDPKMTTSLVNEFVNNTGQDANSTNDPFRILSKRE 159 >ref|NP_372915.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375502.1| hypothetical protein, similar to response regulators of two-component regulatory [Staphylococcus aureus subsp. aureus N315] ref|NP_647130.1| ORFID:MW2313~hypothetical protein, similar to response regulators of two-component regulatory [Staphylococcus aureus subsp. aureus MW2] pir||H90039 hypothetical protein SA2179 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43481.1| SA2179 [Staphylococcus aureus subsp. aureus N315] dbj|BAB58553.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB96178.1| MW2313 [Staphylococcus aureus subsp. aureus MW2] Length = 217 Score = 232 bits (591), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 109/159 (68%), Positives = 135/159 (84%), Gaps = 2/159 (1%) Query: 8 MKIVIADDHAMVRSGFSMILNFQDDIEVIGAAADGIEAYAMVAKRRPDILIMDLSMPPGE 67 MKIVIADDHA+VR+GFSMILN+Q+D+EV+ AADG+EAY V + +PD+L+MDLSMPPGE Sbjct: 1 MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGE 60 Query: 68 SGLIATGKIKEDYPDTKILILTMHDDEEYLFHVLKNGASGYVLKSAPDEELLLAIRTIYE 127 SGLIAT KI + +P+TKILILTM DDEEYLFHVL+NGA GY+LK+APDE+LLLAIRT+Y+ Sbjct: 61 SGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYK 120 Query: 128 GGTYIHPKMATSLVREFIKKDK--TASTEDLFELLSKRE 164 G TY+ K+ TSLV EF+ TA+T D F++LSKRE Sbjct: 121 GETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRE 159 >ref|NP_765524.1| response regulators of two-component regulatory [Staphylococcus epidermidis ATCC 12228] gb|AAO05610.1| response regulators of two-component regulatory [Staphylococcus epidermidis ATCC 12228] Length = 218 Score = 231 bits (588), Expect = 9e-60, Method: Compositional matrix adjust. Identities = 106/160 (66%), Positives = 137/160 (85%), Gaps = 3/160 (1%) Query: 8 MKIVIADDHAMVRSGFSMILNFQDDIEVIGAAADGIEAYAMVAKRRPDILIMDLSMPPGE 67 MKIVIADDHA+VR+GFSMILN+Q+D+EV+ AADG+EAY V + RPD+LI+DLSMPPGE Sbjct: 1 MKIVIADDHAVVRTGFSMILNYQEDMEVVATAADGVEAYQKVLEHRPDVLILDLSMPPGE 60 Query: 68 SGLIATGKIKEDYPDTKILILTMHDDEEYLFHVLKNGASGYVLKSAPDEELLLAIRTIYE 127 SGLIAT KI E +P+TKILILTM DDEEYLFH+LK+GA GY+LK++PDE+L+LA+RT+Y+ Sbjct: 61 SGLIATSKISESFPETKILILTMFDDEEYLFHMLKSGAKGYILKNSPDEQLILAVRTVYQ 120 Query: 128 GGTYIHPKMATSLVREFIKK---DKTASTEDLFELLSKRE 164 G TY+ K+ TSLV EF+ + D+ +S+ D F++LSKRE Sbjct: 121 GETYVDMKLTTSLVNEFVNQSQTDEVSSSSDPFKILSKRE 160 >gb|AAD10462.1| orfx; function unknown; similar to response regulators of two-component regulatory systems; Method: conceptual translation supplied by author. [Staphylococcus carnosus] Length = 185 Score = 182 bits (463), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 87/127 (68%), Positives = 102/127 (80%), Gaps = 2/127 (1%) Query: 40 ADGIEAYAMVAKRRPDILIMDLSMPPGESGLIATGKIKEDYPDTKILILTMHDDEEYLFH 99 ADG+EAY V + +PD+LIMDLSMPPGESGLIAT KI E +PDTKILILTM+DDEEYLFH Sbjct: 1 ADGVEAYQKVMQHQPDVLIMDLSMPPGESGLIATSKIVESFPDTKILILTMYDDEEYLFH 60 Query: 100 VLKNGASGYVLKSAPDEELLLAIRTIYEGGTYIHPKMATSLVREFIKK--DKTASTEDLF 157 VL+NGA GY+LK+APDE+L+ A+RT+Y G TYI PKM TSLV EF+ ST D F Sbjct: 61 VLRNGAKGYILKNAPDEQLISAVRTVYRGDTYIDPKMTTSLVNEFVNNTGQDANSTNDPF 120 Query: 158 ELLSKRE 164 +LSKRE Sbjct: 121 RILSKRE 127 >ref|NP_785095.1| response regulator [Lactobacillus plantarum WCFS1] emb|CAD63943.1| response regulator [Lactobacillus plantarum WCFS1] Length = 217 Score = 140 bits (352), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 65/123 (52%), Positives = 90/123 (73%) Query: 10 IVIADDHAMVRSGFSMILNFQDDIEVIGAAADGIEAYAMVAKRRPDILIMDLSMPPGESG 69 ++IADDHA+VRSG + ++N Q + EVI AADG Y V + DIL+MDLSMPPGESG Sbjct: 4 VLIADDHAVVRSGLAYLINQQPNFEVIDEAADGTSTYLRVEQGDVDILVMDLSMPPGESG 63 Query: 70 LIATGKIKEDYPDTKILILTMHDDEEYLFHVLKNGASGYVLKSAPDEELLLAIRTIYEGG 129 LI T +I E +PD +ILIL+MH+++EY+ L NGA Y++KS+ D+ELL A++T+ G Sbjct: 64 LITTQRIHEHFPDVRILILSMHEEQEYINKALHNGAMSYIMKSSSDDELLKALKTVANGE 123 Query: 130 TYI 132 Y+ Sbjct: 124 EYV 126 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 251,293,516 Number of extensions: 10381113 Number of successful extensions: 32471 Number of sequences better than 1.0e-05: 1045 Number of HSP's gapped: 33067 Number of HSP's successfully gapped: 1045 Length of query: 188 Length of database: 757,237,578 Length adjustment: 118 Effective length of query: 70 Effective length of database: 436,855,896 Effective search space: 30579912720 Effective search space used: 30579912720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 122 (51.6 bits)