BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0351.0008.p (75 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_349916.1| Predicted transcriptional regulator [Clostridiu... 98 6e-20 ref|NP_722276.1| putative transcriptional regulator [Streptococc... 79 3e-14 ref|NP_687204.1| transcriptional regulator, Cro/CI family [Strep... 75 6e-13 ref|NP_653620.1| HTH_XRE, Helix-turn-helix XRE-family like prote... 74 8e-13 ref|NP_981571.1| DNA-binding protein [Bacillus cereus ATCC 10987... 74 8e-13 >ref|NP_349916.1| Predicted transcriptional regulator [Clostridium acetobutylicum] pir||E97308 probable transcription regulator [imported] - Clostridium acetobutylicum gb|AAK81256.1| Predicted transcriptional regulator [Clostridium acetobutylicum] Length = 69 Score = 97.8 bits (242), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 46/67 (68%), Positives = 59/67 (88%) Query: 3 VKTRIRELRKERRISQEELAKALRVTRHTITSIENEKYTASLPLAYKISRFFGLPIEDIF 62 +KTRI+ELRK+ ++SQEELA A+ VTR TITS+E EKYTASL LAYKI+ +FGL IE+IF Sbjct: 1 MKTRIQELRKQHKLSQEELALAVGVTRQTITSLEREKYTASLVLAYKIAHYFGLTIEEIF 60 Query: 63 DFSDVED 69 DFS++E+ Sbjct: 61 DFSEIEE 67 >ref|NP_722276.1| putative transcriptional regulator [Streptococcus mutans UA159] gb|AAN59582.1| putative transcriptional regulator [Streptococcus mutans UA159] Length = 81 Score = 79.0 bits (193), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 38/64 (59%), Positives = 49/64 (76%) Query: 3 VKTRIRELRKERRISQEELAKALRVTRHTITSIENEKYTASLPLAYKISRFFGLPIEDIF 62 ++TRI+ELRK ++SQ ELA AL VTR TI S+E +Y ASL LAYKI+++FG IED+F Sbjct: 1 MQTRIQELRKINKLSQSELADALSVTRQTIISLEKGRYNASLELAYKIAKYFGTTIEDVF 60 Query: 63 DFSD 66 F D Sbjct: 61 IFED 64 >ref|NP_687204.1| transcriptional regulator, Cro/CI family [Streptococcus agalactiae 2603V/R] gb|AAM99076.1| transcriptional regulator, Cro/CI family [Streptococcus agalactiae 2603V/R] Length = 68 Score = 74.7 bits (182), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 36/67 (53%), Positives = 51/67 (76%) Query: 3 VKTRIRELRKERRISQEELAKALRVTRHTITSIENEKYTASLPLAYKISRFFGLPIEDIF 62 +K +++LRK R++SQ ELA AL VTR TI S+E EKYTASL LA+KI+R+F IE++F Sbjct: 1 MKNSLQKLRKSRKLSQAELAVALGVTRQTIISLEKEKYTASLELAFKIARYFDKQIEEVF 60 Query: 63 DFSDVED 69 +++ E Sbjct: 61 IYTESEG 67 >ref|NP_653620.1| HTH_XRE, Helix-turn-helix XRE-family like proteins [Bacillus anthracis A2012] Length = 65 Score = 74.3 bits (181), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 32/64 (50%), Positives = 48/64 (75%) Query: 1 VPVKTRIRELRKERRISQEELAKALRVTRHTITSIENEKYTASLPLAYKISRFFGLPIED 60 + VK +I+ELRK+ I+Q E+AKA++VTR TI +IEN Y SL L+ KI+++FG+ +E+ Sbjct: 1 MGVKNKIKELRKQHHITQVEMAKAMQVTRQTIVAIENHHYNPSLELSLKIAKYFGVKVEE 60 Query: 61 IFDF 64 IF Sbjct: 61 IFTL 64 >ref|NP_981571.1| DNA-binding protein [Bacillus cereus ATCC 10987] gb|AAS44179.1| DNA-binding protein [Bacillus cereus ATCC 10987] Length = 66 Score = 74.3 bits (181), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 32/64 (50%), Positives = 48/64 (75%) Query: 1 VPVKTRIRELRKERRISQEELAKALRVTRHTITSIENEKYTASLPLAYKISRFFGLPIED 60 + VK +I+ELRK+ I+Q E+AKA++VTR TI +IEN Y SL L+ KI+++FG+ +E+ Sbjct: 1 MGVKNKIKELRKQHHITQVEMAKAMQVTRQTIVAIENHHYNPSLELSLKIAKYFGVKVEE 60 Query: 61 IFDF 64 IF Sbjct: 61 IFTL 64 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.323 0.140 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 100,339,492 Number of extensions: 3182552 Number of successful extensions: 12328 Number of sequences better than 1.0e-05: 100 Number of HSP's gapped: 12333 Number of HSP's successfully gapped: 100 Length of query: 75 Length of database: 757,237,578 Length adjustment: 45 Effective length of query: 30 Effective length of database: 635,058,123 Effective search space: 19051743690 Effective search space used: 19051743690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)