BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0351.0002.p (104 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_356003.1| AGR_L_448p [Agrobacterium tumefaciens] >gi|1793... 80 2e-14 ref|NP_106952.1| transcriptional regulator [Mesorhizobium loti M... 73 2e-12 ref|NP_438108.1| alpha-galactoside utilization transcriptional r... 73 3e-12 gb|EAI28859.1| unknown [environmental sequence] 72 4e-12 ref|NP_811285.1| transcriptional regulator [Bacteroides thetaiot... 72 4e-12 >ref|NP_356003.1| AGR_L_448p [Agrobacterium tumefaciens] ref|NP_535137.1| transcriptional regulator, AraC family [Agrobacterium tumefaciens str. C58 (U. Washington)] pir||B98158 agpt protein (AF235048) [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pir||AG3129 transcription regulator, AraC family agpT [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gb|AAK88788.1| AGR_L_448p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL45453.1| transcriptional regulator, AraC family [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 295 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 41/99 (41%), Positives = 58/99 (58%), Gaps = 1/99 (1%) Query: 1 LQKAVSLINEHFTEPLLVSNLAAAVGYSVQHFQRLFLQEYGITPHRYLQNLRLERALQLI 60 LQ+ +S I+ H E L VS+LAA G S HF R+F G+ P ++ RL RA +L+ Sbjct: 186 LQQVLSYIDSHLGERLSVSDLAAVAGLSRAHFSRIFTASEGLPPAEFVLQRRLRRAAKLL 245 Query: 61 RENADIPVQEIALNLGMET-NYFIRVFRNTYGCTPGTMR 98 A+IP++E+++ G E NYF +VFR YG P R Sbjct: 246 TTAANIPIKEVSVLCGFEDPNYFSKVFRRLYGINPSEFR 284 >ref|NP_106952.1| transcriptional regulator [Mesorhizobium loti MAFF303099] dbj|BAB52738.1| transcriptional regulator [Mesorhizobium loti] Length = 351 Score = 73.2 bits (178), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 37/99 (37%), Positives = 55/99 (55%), Gaps = 1/99 (1%) Query: 1 LQKAVSLINEHFTEPLLVSNLAAAVGYSVQHFQRLFLQEYGITPHRYLQNLRLERALQLI 60 +Q + IN + PL V++L G S HF R F + G+ P ++ RL+RA +L+ Sbjct: 230 MQPVIDHINANLDRPLPVADLVQISGLSRAHFSRCFAESEGLPPAEFVLQQRLQRAAKLL 289 Query: 61 RENADIPVQEIALNLGME-TNYFIRVFRNTYGCTPGTMR 98 + +PV+E+A+ G E NYF +VFR YG TP R Sbjct: 290 TKADFLPVKEVAILCGFEDANYFSKVFRRLYGTTPSQFR 328 >ref|NP_438108.1| alpha-galactoside utilization transcriptional regulator, AraC family protein [Sinorhizobium meliloti 1021] pir||H96037 alpha-galactoside utilization transcription regulator, AraC family protein [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB gb|AAF60312.1| AgpT [Sinorhizobium meliloti] emb|CAC49968.1| alpha-galactoside utilization transcriptional regulator, AraC family protein [Sinorhizobium meliloti] Length = 313 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 37/99 (37%), Positives = 56/99 (56%), Gaps = 1/99 (1%) Query: 1 LQKAVSLINEHFTEPLLVSNLAAAVGYSVQHFQRLFLQEYGITPHRYLQNLRLERALQLI 60 +Q + I + +PL V LA G S HF R F G+ P ++ RL+RA++L+ Sbjct: 186 MQHVIDHILGNLDKPLPVEELARISGLSRAHFSRAFAASEGMPPAEFVLQKRLQRAVKLL 245 Query: 61 RENADIPVQEIALNLGMET-NYFIRVFRNTYGCTPGTMR 98 + AD+PV+E+A+ G E NYF +VFR +G +P R Sbjct: 246 TKTADLPVKEVAILSGFEDPNYFAKVFRRVFGASPTEFR 284 >gb|EAI28859.1| unknown [environmental sequence] Length = 125 Score = 72.0 bits (175), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%) Query: 8 INEHFTEPLLVSNLAAAVGYSVQHFQRLFLQEYGITPHRYLQNLRLERALQLIRENADIP 67 + H +EPL +++LAA G+ ++ F +LF++ +G TPHRYLQ LRL+ +L L+ + + Sbjct: 31 LRTHLSEPLRIADLAAHCGFGMRRFHQLFIEAFGETPHRYLQRLRLDTSLGLL-SDPRLS 89 Query: 68 VQEIALNLGM-ETNYFIRVFRNTYGCTPGTMRKRLH 102 + +IAL +G + + + F +G PG R H Sbjct: 90 LSDIALEIGFGDQSAYTHAFTRRFGLAPGQWRALRH 125 >ref|NP_811285.1| transcriptional regulator [Bacteroides thetaiotaomicron VPI-5482] gb|AAO77479.1| transcriptional regulator [Bacteroides thetaiotaomicron VPI-5482] Length = 315 Score = 72.0 bits (175), Expect = 4e-12, Method: Composition-based stats. Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 1/100 (1%) Query: 1 LQKAVSLINEHFTEPLLVSNLAAAVGYSVQHFQRLFLQEYGITPHRYLQNLRLERALQLI 60 + + + I+ H +PL + ++A +S HF R+F G TP Y+Q LR+E+A + Sbjct: 15 INRVMDYIDIHLDQPLELKSIAEIANFSPFHFHRIFTFLIGETPIDYIQRLRIEKAACRL 74 Query: 61 RENADIPVQEIALNLGMET-NYFIRVFRNTYGCTPGTMRK 99 REN DI + EIA + G T + F RVF+ +G TP RK Sbjct: 75 RENMDISISEIADSCGFCTVSLFSRVFKKFFGLTPSQFRK 114 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.325 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 140,479,403 Number of extensions: 4498346 Number of successful extensions: 16799 Number of sequences better than 1.0e-05: 311 Number of HSP's gapped: 17100 Number of HSP's successfully gapped: 311 Length of query: 104 Length of database: 757,237,578 Length adjustment: 71 Effective length of query: 33 Effective length of database: 564,465,549 Effective search space: 18627363117 Effective search space used: 18627363117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 120 (50.8 bits)