BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0350.0050.p (87 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_471114.1| similar to conserved hypothetical proteins [Lis... 106 2e-22 ref|NP_465195.1| similar to conserved hypothetical proteins [Lis... 104 5e-22 ref|NP_390946.1| ytjA [Bacillus subtilis] >gi|14286083|sp|O34601... 102 2e-21 ref|ZP_00164553.1| hypothetical protein Selo071401 [Synechococcu... 101 5e-21 ref|NP_602917.1| Alpha-hemolysin [Fusobacterium nucleatum subsp.... 101 7e-21 >ref|NP_471114.1| similar to conserved hypothetical proteins [Listeria innocua] sp|Q92AZ0|YH78_LISIN Hypothetical UPF0161 protein Lin1778 pir||AI1654 conserved hypothetical protein homolog lin1778 [imported] - Listeria innocua (strain Clip11262) emb|CAC97009.1| lin1778 [Listeria innocua] Length = 88 Score = 106 bits (264), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 45/73 (61%), Positives = 59/73 (80%) Query: 5 RRAIQAPIRVYRKYISPIKPATCRFYPTCSAYALEAIEVHGPVKGSWLAAKRIARCHPFH 64 ++ + IR+Y+KYIS PATCRFYPTCSAY +EAIE HG +KGS+LA +RI++CHPFH Sbjct: 2 KKMLIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIETHGALKGSYLAIRRISKCHPFH 61 Query: 65 PGGLDPVPPRDER 77 GGLD VPP+ ++ Sbjct: 62 KGGLDFVPPKKDK 74 >ref|NP_465195.1| similar to conserved hypothetical proteins [Listeria monocytogenes EGD-e] sp|Q8Y6L4|YG70_LISMO Hypothetical UPF0161 protein Lmo1670 pir||AF1283 conserved hypothetical proteins homolog lmo1670 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99748.1| lmo1670 [Listeria monocytogenes] Length = 88 Score = 104 bits (260), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 44/73 (60%), Positives = 59/73 (80%) Query: 5 RRAIQAPIRVYRKYISPIKPATCRFYPTCSAYALEAIEVHGPVKGSWLAAKRIARCHPFH 64 ++ + IR+Y+KYIS PATCRFYPTCSAY +EAI+ HG +KGS+LA +RI++CHPFH Sbjct: 2 KKILIGGIRLYQKYISRFTPATCRFYPTCSAYGIEAIQTHGALKGSYLAIRRISKCHPFH 61 Query: 65 PGGLDPVPPRDER 77 GGLD VPP+ ++ Sbjct: 62 KGGLDFVPPKKDK 74 >ref|NP_390946.1| ytjA [Bacillus subtilis] sp|O34601|YTJA_BACSU Hypothetical UPF0161 protein ytjA pir||H69993 hypothetical protein ytjA - Bacillus subtilis gb|AAC00372.1| YtjA [Bacillus subtilis] emb|CAB15046.1| ytjA [Bacillus subtilis subsp. subtilis str. 168] Length = 75 Score = 102 bits (254), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 43/68 (63%), Positives = 54/68 (79%) Query: 10 APIRVYRKYISPIKPATCRFYPTCSAYALEAIEVHGPVKGSWLAAKRIARCHPFHPGGLD 69 A IR Y+K+ISP+ P TCRFYPTCS Y +EAI+ HG +KG WL KRI +CHPFHPGG+D Sbjct: 7 ALIRGYQKFISPLTPPTCRFYPTCSQYGIEAIKTHGALKGGWLTIKRILKCHPFHPGGVD 66 Query: 70 PVPPRDER 77 PVP + ++ Sbjct: 67 PVPEKKQK 74 >ref|ZP_00164553.1| hypothetical protein Selo071401 [Synechococcus elongatus PCC 7942] Length = 82 Score = 101 bits (252), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 45/69 (65%), Positives = 54/69 (78%) Query: 5 RRAIQAPIRVYRKYISPIKPATCRFYPTCSAYALEAIEVHGPVKGSWLAAKRIARCHPFH 64 + + A I+ YR++ISP+ PA+CRFYPTCS Y LEAI+ GP+KGSWL RI RCHPFH Sbjct: 2 KLLLLALIQFYRRWISPLTPASCRFYPTCSQYGLEAIDRFGPLKGSWLTLCRILRCHPFH 61 Query: 65 PGGLDPVPP 73 PGG DPVPP Sbjct: 62 PGGYDPVPP 70 >ref|NP_602917.1| Alpha-hemolysin [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] sp|Q8RHA5|Y003_FUSNN Hypothetical UPF0161 protein FN0003 gb|AAL94216.1| hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 82 Score = 101 bits (251), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 44/71 (61%), Positives = 54/71 (76%) Query: 12 IRVYRKYISPIKPATCRFYPTCSAYALEAIEVHGPVKGSWLAAKRIARCHPFHPGGLDPV 71 IR Y+K+ISP+ PA CRFYPTCS Y LEAI+ HG +KG++LA +RI +CHPFH GG DPV Sbjct: 9 IRFYQKFISPMFPAKCRFYPTCSQYTLEAIKEHGTIKGTYLAIRRILKCHPFHEGGYDPV 68 Query: 72 PPRDERLSGDK 82 P R + S K Sbjct: 69 PKRKNKNSEGK 79 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.138 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 144,583,612 Number of extensions: 4998275 Number of successful extensions: 10007 Number of sequences better than 1.0e-05: 454 Number of HSP's gapped: 9995 Number of HSP's successfully gapped: 454 Length of query: 87 Length of database: 757,237,578 Length adjustment: 56 Effective length of query: 31 Effective length of database: 605,192,034 Effective search space: 18760953054 Effective search space used: 18760953054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)