BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0350.0015.p (71 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_269911.1| putative transcription regulator [Streptococcus... 100 1e-20 ref|NP_720638.1| putative transcriptional regulator [Streptococc... 100 2e-20 ref|NP_345880.1| transcriptional repressor, putative [Streptococ... 87 1e-16 ref|NP_464276.1| lmo0749 [Listeria monocytogenes EGD-e] >gi|2551... 86 3e-16 ref|ZP_00097246.1| COG1476: Predicted transcriptional regulators... 77 9e-14 >ref|NP_269911.1| putative transcription regulator [Streptococcus pyogenes] ref|NP_607983.1| putative transcription regulator [Streptococcus pyogenes MGAS8232] ref|NP_665469.1| putative transcription regulator [Streptococcus pyogenes MGAS315] ref|NP_802928.1| putative transcription regulator [Streptococcus pyogenes SSI-1] gb|AAK34632.1| putative transcription regulator [Streptococcus pyogenes M1 GAS] gb|AAL98482.1| putative transcription regulator [Streptococcus pyogenes MGAS8232] gb|AAM80272.1| putative transcription regulator [Streptococcus pyogenes MGAS315] dbj|BAC64761.1| putative transcription regulator [Streptococcus pyogenes SSI-1] Length = 68 Score = 100 bits (249), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 46/64 (71%), Positives = 53/64 (82%) Query: 3 KNLRLKASRAAKDMSQKQLADAVGVTRQTIIAIENGDYNPTIRLCIEICLTLGKTLDELF 62 KNL+LKA+RA KD+SQ+ LAD VGV+RQTI A+E GDYNPTI LCI IC L KTLD+LF Sbjct: 2 KNLKLKAARAGKDLSQQALADLVGVSRQTIAAVEKGDYNPTINLCIAICRVLDKTLDDLF 61 Query: 63 WEGD 66 WE D Sbjct: 62 WEAD 65 >ref|NP_720638.1| putative transcriptional regulator [Streptococcus mutans UA159] gb|AAN57944.1| putative transcriptional regulator [Streptococcus mutans UA159] Length = 64 Score = 100 bits (248), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 46/62 (74%), Positives = 53/62 (85%) Query: 3 KNLRLKASRAAKDMSQKQLADAVGVTRQTIIAIENGDYNPTIRLCIEICLTLGKTLDELF 62 KNLRLKA+RA KD+SQ+ LAD VGV+RQTI A+E GDYNPTI LCI+IC L K+LDELF Sbjct: 2 KNLRLKAARAGKDLSQQALADLVGVSRQTIAAVEKGDYNPTINLCIKICKALDKSLDELF 61 Query: 63 WE 64 WE Sbjct: 62 WE 63 >ref|NP_345880.1| transcriptional repressor, putative [Streptococcus pneumoniae TIGR4] ref|NP_358872.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] pir||G95165 transcription repressor, probable [imported] - Streptococcus pneumoniae (strain TIGR4) pir||F98031 conserved hypothetical protein spr1279 [imported] - Streptococcus pneumoniae (strain R6) gb|AAK75520.1| transcriptional repressor, putative [Streptococcus pneumoniae TIGR4] gb|AAL00083.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] Length = 79 Score = 87.0 bits (214), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 40/64 (62%), Positives = 50/64 (78%) Query: 1 MGKNLRLKASRAAKDMSQKQLADAVGVTRQTIIAIENGDYNPTIRLCIEICLTLGKTLDE 60 + KNL+LK +R +D++Q QLA+AVGVTRQTI IE G YNP++ LC IC LGKTLD+ Sbjct: 11 VAKNLKLKLARVERDLTQGQLAEAVGVTRQTIGLIEAGKYNPSLSLCQSICRCLGKTLDQ 70 Query: 61 LFWE 64 LFWE Sbjct: 71 LFWE 74 >ref|NP_464276.1| lmo0749 [Listeria monocytogenes EGD-e] pir||AE1168 hypothetical protein lmo0749 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC98827.1| lmo0749 [Listeria monocytogenes] Length = 68 Score = 85.9 bits (211), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 37/64 (57%), Positives = 50/64 (78%) Query: 3 KNLRLKASRAAKDMSQKQLADAVGVTRQTIIAIENGDYNPTIRLCIEICLTLGKTLDELF 62 KN+ +K +R KD+SQ++LA + V+RQTI ++E G+YNPT+ LCI IC LGKTLD+LF Sbjct: 2 KNINMKVARVEKDISQEELAKLIHVSRQTISSVEAGNYNPTLNLCIAICKALGKTLDDLF 61 Query: 63 WEGD 66 WE D Sbjct: 62 WEED 65 >ref|ZP_00097246.1| COG1476: Predicted transcriptional regulators [Desulfitobacterium hafniense] Length = 55 Score = 77.4 bits (189), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 36/53 (67%), Positives = 44/53 (83%) Query: 16 MSQKQLADAVGVTRQTIIAIENGDYNPTIRLCIEICLTLGKTLDELFWEGDKH 68 MSQ+QLA AVGVTRQTI IE G +NP+++LCI IC LGKTL++LFWE DK+ Sbjct: 1 MSQEQLAIAVGVTRQTIGMIEAGKFNPSLQLCIAICKALGKTLNDLFWEDDKN 53 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 99,036,318 Number of extensions: 2934344 Number of successful extensions: 7893 Number of sequences better than 1.0e-05: 50 Number of HSP's gapped: 7899 Number of HSP's successfully gapped: 50 Length of query: 71 Length of database: 757,237,578 Length adjustment: 42 Effective length of query: 29 Effective length of database: 643,203,420 Effective search space: 18652899180 Effective search space used: 18652899180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)