BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0350.0012.p (49 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_653642.1| DUF24, Protein of unknown function DUF24 [Bacil... 73 2e-12 ref|NP_347485.1| Predicted transcriptional regulator [Clostridiu... 71 9e-12 ref|NP_244169.1| BH3303~unknown conserved protein in bacilli [Ba... 69 5e-11 ref|NP_470520.1| similar to unknown protein [Listeria innocua] >... 66 3e-10 ref|NP_391248.1| similar to hypothetical proteins [Bacillus subt... 65 4e-10 >ref|NP_653642.1| DUF24, Protein of unknown function DUF24 [Bacillus anthracis A2012] ref|NP_834861.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] ref|NP_847596.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_981594.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP12062.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP29082.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS44202.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 104 Score = 73.2 bits (178), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 32/49 (65%), Positives = 42/49 (85%) Query: 1 MKDLECEGILVRHVYPETPVRIEYELTAKGRALEPVMQQIQSWAESWVE 49 +K+LE EGI+VR+VYPE PVRIEY LT KG+ALE VM ++Q+WAE W++ Sbjct: 56 LKELESEGIVVRNVYPEVPVRIEYGLTDKGKALESVMDEVQNWAEKWMK 104 >ref|NP_347485.1| Predicted transcriptional regulator [Clostridium acetobutylicum] pir||F97004 probable transcription regulator [imported] - Clostridium acetobutylicum gb|AAK78825.1| Predicted transcriptional regulator [Clostridium acetobutylicum] Length = 102 Score = 70.9 bits (172), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 33/48 (68%), Positives = 38/48 (79%) Query: 1 MKDLECEGILVRHVYPETPVRIEYELTAKGRALEPVMQQIQSWAESWV 48 ++LE +GI+VR VY ETPVRIEYELT KGR LE VMQ+IQ WAE W Sbjct: 55 FRELEKQGIVVRKVYAETPVRIEYELTEKGRELESVMQEIQKWAEKWT 102 >ref|NP_244169.1| BH3303~unknown conserved protein in bacilli [Bacillus halodurans] pir||T44493 conserved hypothetical protein YVAP [imported] - Bacillus halodurans dbj|BAA83951.1| YVAP [Bacillus halodurans] dbj|BAB07022.1| BH3303~unknown conserved protein in bacilli [Bacillus halodurans] Length = 107 Score = 68.6 bits (166), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 29/49 (59%), Positives = 41/49 (83%) Query: 1 MKDLECEGILVRHVYPETPVRIEYELTAKGRALEPVMQQIQSWAESWVE 49 +KDLE GI+ R VYPETPVRIEY LT KG ALEPV++++++W++ W++ Sbjct: 54 LKDLEQHGIVKRDVYPETPVRIEYSLTEKGLALEPVLKKVEAWSQEWLD 102 >ref|NP_470520.1| similar to unknown protein [Listeria innocua] ref|NP_464745.1| similar to unknown protein [Listeria monocytogenes EGD-e] pir||AD1227 hypothetical protein lmo1220 [imported] - Listeria monocytogenes (strain EGD-e) pir||AF1580 hypothetical protein homolog lin1183 [imported] - Listeria innocua (strain Clip11262) emb|CAC99298.1| lmo1220 [Listeria monocytogenes] emb|CAC96414.1| lin1183 [Listeria innocua] Length = 107 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 31/49 (63%), Positives = 39/49 (79%) Query: 1 MKDLECEGILVRHVYPETPVRIEYELTAKGRALEPVMQQIQSWAESWVE 49 +K+LE I +R VYPETPVRIEYELT KG+AL+ VM ++Q WA+ WVE Sbjct: 56 LKELEEMDICLRQVYPETPVRIEYELTEKGKALQEVMLEVQCWADKWVE 104 >ref|NP_391248.1| similar to hypothetical proteins [Bacillus subtilis] pir||E70028 conserved hypothetical protein yvaP - Bacillus subtilis emb|CAB15373.1| yvaP [Bacillus subtilis subsp. subtilis str. 168] Length = 236 Score = 65.5 bits (158), Expect = 4e-10, Method: Composition-based stats. Identities = 27/49 (55%), Positives = 37/49 (75%) Query: 1 MKDLECEGILVRHVYPETPVRIEYELTAKGRALEPVMQQIQSWAESWVE 49 +K+LE EG++ R V PETPVRIEY LT KG+AL P++ +I WA W++ Sbjct: 138 LKELELEGVVKRDVIPETPVRIEYSLTDKGKALAPILGEISKWATEWID 186 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.133 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 76,640,706 Number of extensions: 1828710 Number of successful extensions: 3876 Number of sequences better than 1.0e-05: 25 Number of HSP's gapped: 3879 Number of HSP's successfully gapped: 25 Length of query: 49 Length of database: 757,237,578 Length adjustment: 22 Effective length of query: 27 Effective length of database: 697,505,400 Effective search space: 18832645800 Effective search space used: 18832645800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)