BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0346.0031.p (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_815306.1| transcriptional regulator, AraC family [Enteroc... 89 2e-16 ref|NP_721285.1| putative MSM operon regulatory protein [Strepto... 86 2e-15 ref|NP_244709.1| two-component response regulator [Bacillus halo... 86 2e-15 ref|ZP_00181445.1| hypothetical protein Mther052901 [Moorella th... 86 3e-15 ref|ZP_00036694.1| COG4753: Response regulator containing CheY-l... 85 5e-15 >ref|NP_815306.1| transcriptional regulator, AraC family [Enterococcus faecalis V583] gb|AAO81376.1| transcriptional regulator, AraC family [Enterococcus faecalis V583] Length = 272 Score = 89.4 bits (220), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 65/193 (33%), Positives = 103/193 (53%), Gaps = 22/193 (11%) Query: 351 YLKGLLVNRTVDTSILSLFRLDIVQLVYSFLKMKGIQVHKLYSGKVNDRLQLHSLTSIE- 409 YL+GL N + S L LD+ L +FL+ VH+L +V LQ+ +L IE Sbjct: 91 YLEGLARNVFPNKSAL----LDLSHLHGAFLEKAWQIVHELNHQEVESALQIKALV-IEL 145 Query: 410 ----------DMEEYLEYLVNTAMKYRDLTAQPKSVAEEIKQYIHAHYGDELTRNDLAEI 459 D E +E ++ K + +++ Y+ H+ +E+T LAE+ Sbjct: 146 LVYILRSLAVDQENKIETRLSKTEKRK------RNLVNHTIYYLETHHDEEITLEQLAEM 199 Query: 460 VYLNPDYLARLFKKETGVALGSYVIQVRIAAAKQLLETTRLSVYTIANKVGYTNYSYFSK 519 +Y+ P YL++ FK TGV +Y+IQ+R+ AK+LL+ LSV +A VGY + +FSK Sbjct: 200 LYVTPTYLSKTFKAATGVGPINYLIQIRLNHAKELLKNDSLSVKEVAKTVGYEDAYHFSK 259 Query: 520 LFKQEVGLSPNEY 532 LFK+ G SP+++ Sbjct: 260 LFKKYYGKSPSQF 272 >ref|NP_721285.1| putative MSM operon regulatory protein [Streptococcus mutans UA159] sp|Q00753|MSMR_STRMU Msm operon regulatory protein gb|AAN58591.1| putative MSM operon regulatory protein [Streptococcus mutans UA159] Length = 278 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 70/106 (66%) Query: 430 AQPKSVAEEIKQYIHAHYGDELTRNDLAEIVYLNPDYLARLFKKETGVALGSYVIQVRIA 489 + K+ ++K+ IH+ YG L ND+A+ + L+ YL ++F+K T +++ Y++QVR+ Sbjct: 169 SSTKAYVNQVKKIIHSQYGSSLRVNDIAKKLNLSRSYLYKIFRKSTNLSIKEYILQVRMK 228 Query: 490 AAKQLLETTRLSVYTIANKVGYTNYSYFSKLFKQEVGLSPNEYKKE 535 ++ LLE +LS+ I+N VG+++ FSK FK G SP++++KE Sbjct: 229 RSQYLLENPKLSIAEISNSVGFSDSLAFSKAFKNYFGKSPSKFRKE 274 >ref|NP_244709.1| two-component response regulator [Bacillus halodurans] pir||B84130 two-component response regulator BH3842 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07561.1| two-component response regulator [Bacillus halodurans] Length = 530 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 43/118 (36%), Positives = 76/118 (64%), Gaps = 2/118 (1%) Query: 417 YLVNTAMKYRDLTAQPKSVAEEIKQYIHAHYGDELTRNDLAEIVYLNPDYLARLFKKETG 476 ++V T ++R T +S+ + Y+H H+ + LT +DLA+ + L+P Y+++LFK+ Sbjct: 400 HIVRTLQEWR--TTDEQSLMLLARDYVHDHFREPLTLDDLAKHIGLSPYYVSKLFKERFD 457 Query: 477 VALGSYVIQVRIAAAKQLLETTRLSVYTIANKVGYTNYSYFSKLFKQEVGLSPNEYKK 534 + YV Q+R+ AKQLL T+ S+ I ++GY + +YFS++FK+ G SP++Y+K Sbjct: 458 LTFSEYVTQLRVEHAKQLLSLTQKSLKEITYEIGYKDPNYFSRVFKKLTGKSPSDYRK 515 >ref|ZP_00181445.1| hypothetical protein Mther052901 [Moorella thermoacetica ATCC 39073] Length = 283 Score = 85.5 bits (210), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 47/142 (33%), Positives = 84/142 (59%), Gaps = 6/142 (4%) Query: 400 LQLHSLTSIEDMEEYLEYLVNTAMKYRDLTAQPKS-----VAEEIKQYIHAHYGDE-LTR 453 L+L + + +E+ + +L+ + +L A+ S + + + +YI +Y E L+ Sbjct: 136 LKLREIDEADTVEKAVLWLLAVGNAFIELIAERNSSEGEGIIDRVVEYIQKNYSSESLSV 195 Query: 454 NDLAEIVYLNPDYLARLFKKETGVALGSYVIQVRIAAAKQLLETTRLSVYTIANKVGYTN 513 ++A YL+P YL +LFKK+ G +L ++ +VRI AK LL T ++ ++A + G+ Sbjct: 196 KEIARASYLSPAYLGQLFKKKMGYSLTEHINKVRIEQAKLLLRQTEQTIESVAIQTGFKE 255 Query: 514 YSYFSKLFKQEVGLSPNEYKKE 535 SYF K+FK+ GLSPNEY+++ Sbjct: 256 RSYFCKVFKKITGLSPNEYRRK 277 >ref|ZP_00036694.1| COG4753: Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Enterococcus faecium] Length = 483 Score = 84.7 bits (208), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 41/92 (44%), Positives = 64/92 (69%) Query: 443 IHAHYGDELTRNDLAEIVYLNPDYLARLFKKETGVALGSYVIQVRIAAAKQLLETTRLSV 502 +H HY + LT +++E ++LN YL +LFKKET + +Y+ +R+ AKQLL + ++ Sbjct: 387 LHQHYQEPLTLKEVSENLHLNVMYLGQLFKKETKKSFSAYLNHLRMEKAKQLLLHSNQNI 446 Query: 503 YTIANKVGYTNYSYFSKLFKQEVGLSPNEYKK 534 IA+++GY N +YFSKLFK+ VG SP EY++ Sbjct: 447 NEIASEIGYNNTTYFSKLFKKIVGRSPKEYRE 478 Score = 61.6 bits (148), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 26/105 (24%), Positives = 60/105 (57%) Query: 23 QKKMDWTALGIETVYTANNVAQAREIVENHSVQILISDIEMPQGSGLSLLAWIRDNDYPI 82 +K +DW +LG + V TA N + ++E + ++++D+ MP+ +GL + + + Sbjct: 20 KKIIDWQSLGFQIVATAENAKEGLAVLEQRQIDLVVTDVTMPEINGLEFIEAAQKERHNF 79 Query: 83 QTILLTNYADFNYAQKAIELQSFEYFLKPIEFDKLMLIIQKAVAR 127 + ++L+ Y +F+Y + ++L + Y +KP+ +L+ ++K R Sbjct: 80 EFMILSGYQEFDYLKGGMQLGAVNYLMKPVNKFELVESLKKIKTR 124 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 767,780,748 Number of extensions: 30531473 Number of successful extensions: 92872 Number of sequences better than 1.0e-05: 684 Number of HSP's gapped: 93395 Number of HSP's successfully gapped: 726 Length of query: 550 Length of database: 757,237,578 Length adjustment: 131 Effective length of query: 419 Effective length of database: 401,559,609 Effective search space: 168253476171 Effective search space used: 168253476171 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 128 (53.9 bits)