BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0346.0025.p (74 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_756981.1| Hypothetical protein yjdI [Escherichia coli CFT... 68 6e-11 gb|EAH27282.1| unknown [environmental sequence] 68 7e-11 emb|CAA73813.1| YjdI-like protein [Lactococcus lactis subsp. lac... 68 8e-11 ref|NP_810407.1| conserved hypothetical protein [Bacteroides the... 68 8e-11 ref|NP_290759.1| orf, hypothetical protein [Escherichia coli O15... 65 5e-10 >ref|NP_756981.1| Hypothetical protein yjdI [Escherichia coli CFT073] gb|AAN83555.1| Hypothetical protein yjdI [Escherichia coli CFT073] Length = 76 Score = 68.2 bits (165), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 29/64 (45%), Positives = 39/64 (60%) Query: 6 KLYYGKNITVKFQPEKCIHSGVCVKGLPAVFNVSRRPWVEPDADAAEAIARHIDKCPSGA 65 + Y G+NI V F C HSG CV+G +FN+ R+PW+ PD + + ID CPSGA Sbjct: 11 RCYTGENIDVYFNTAICQHSGNCVRGNGKLFNLKRKPWIMPDEVDVTTVVKVIDTCPSGA 70 Query: 66 LRYE 69 L+Y Sbjct: 71 LKYR 74 >gb|EAH27282.1| unknown [environmental sequence] Length = 77 Score = 68.2 bits (165), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 31/64 (48%), Positives = 40/64 (62%) Query: 5 QKLYYGKNITVKFQPEKCIHSGVCVKGLPAVFNVSRRPWVEPDADAAEAIARHIDKCPSG 64 +K Y +TV +Q KCIHSG CV+ P VF +PW++ DA ++E I I KCPSG Sbjct: 7 KKEYSNGEVTVVWQSAKCIHSGNCVRNNPEVFQPKEKPWIKIDASSSEKIIETIHKCPSG 66 Query: 65 ALRY 68 AL Y Sbjct: 67 ALSY 70 >emb|CAA73813.1| YjdI-like protein [Lactococcus lactis subsp. lactis] Length = 90 Score = 67.8 bits (164), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 43/68 (63%) Query: 1 MTNDQKLYYGKNITVKFQPEKCIHSGVCVKGLPAVFNVSRRPWVEPDADAAEAIARHIDK 60 + ND + Y G+N+ + + C H+G CV+G P VF VSR+PW+ PD + I++ Sbjct: 17 LKNDYRKYCGENMDIYYNVAICEHAGECVRGNPLVFEVSRKPWIIPDNGDVASNQSVINR 76 Query: 61 CPSGALRY 68 CPSGAL+Y Sbjct: 77 CPSGALKY 84 >ref|NP_810407.1| conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] gb|AAO76601.1| conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] Length = 74 Score = 67.8 bits (164), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 28/63 (44%), Positives = 39/63 (61%) Query: 8 YYGKNITVKFQPEKCIHSGVCVKGLPAVFNVSRRPWVEPDADAAEAIARHIDKCPSGALR 67 Y +T+ +QPE C H+G+CVK LP V++ RPWV+ + E + I KCPSGAL Sbjct: 7 YTNGELTIAWQPEMCQHAGICVKMLPNVYHPKERPWVQIENATTEELIAQISKCPSGALS 66 Query: 68 YEI 70 Y + Sbjct: 67 YRL 69 >ref|NP_290759.1| orf, hypothetical protein [Escherichia coli O157:H7 EDL933] ref|NP_313135.1| hypothetical protein ECs5108 [Escherichia coli O157:H7] ref|NP_418550.1| hypothetical protein b4126 [Escherichia coli K12] sp|P39273|YJDI_ECOLI Hypothetical protein yjdI pir||S56355 hypothetical 8.6K protein (dcub-lysu intergenic region) - Escherichia coli (strain K-12) pir||D91267 hypothetical protein ECs5108 [imported] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) pir||A86108 hypothetical protein yjdI [imported] - Escherichia coli (strain O157:H7, substrain EDL933) gb|AAA97026.1| ORF_o76 [Escherichia coli] gb|AAC77087.1| orf, hypothetical protein [Escherichia coli K12] gb|AAG59325.1| orf, hypothetical protein [Escherichia coli O157:H7 EDL933] dbj|BAB38531.1| hypothetical protein [Escherichia coli O157:H7] Length = 76 Score = 65.1 bits (157), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 28/64 (43%), Positives = 38/64 (59%) Query: 6 KLYYGKNITVKFQPEKCIHSGVCVKGLPAVFNVSRRPWVEPDADAAEAIARHIDKCPSGA 65 + Y G+ I V F C HSG CV+G +FN+ R+PW+ PD + + ID CPSGA Sbjct: 11 RCYTGEKIDVYFNTAICQHSGNCVRGNGKLFNLKRKPWIMPDEVDVATVVKVIDTCPSGA 70 Query: 66 LRYE 69 L+Y Sbjct: 71 LKYR 74 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.136 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 114,879,182 Number of extensions: 3860574 Number of successful extensions: 8005 Number of sequences better than 1.0e-05: 14 Number of HSP's gapped: 8005 Number of HSP's successfully gapped: 14 Length of query: 74 Length of database: 757,237,578 Length adjustment: 44 Effective length of query: 30 Effective length of database: 637,773,222 Effective search space: 19133196660 Effective search space used: 19133196660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)