BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0345.0036.p (138 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_981196.1| conserved hypothetical protein [Bacillus cereus... 112 3e-24 ref|NP_658788.1| hypothetical protein predicted by GeneMark [Bac... 112 3e-24 ref|NP_834456.1| hypothetical protein [Bacillus cereus ATCC 1457... 112 3e-24 ref|NP_390928.1| ytpB [Bacillus subtilis] >gi|33301838|sp|O34707... 110 8e-24 ref|ZP_00112480.1| hypothetical protein [Nostoc punctiforme] 95 7e-19 >ref|NP_981196.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS43804.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 344 Score = 112 bits (280), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 71/126 (56%) Query: 10 KLSTSAAASIRAAYFPHLCGLHIMLDYLIDQDEDRAGGDLNFCNYYDTSDTMLNRIASIV 69 +L A IR YFP++ GLHI+LDY IDQ+EDR GGDLNFC+YY+ +L+R+ V Sbjct: 215 ELHDEDIAKIRQGYFPYVQGLHILLDYFIDQEEDRIGGDLNFCSYYENEQVILDRMKHFV 274 Query: 70 EWARRDVRNLPETSMHRMVIEGLLALYLSDPKXXXXXXXXXXXXXXXXXXPLTRLFFFVN 129 E A + + +LP HR++ GLL +YLSD K LT FF+ N Sbjct: 275 EEAEKSIGDLPHAKFHRLISRGLLGIYLSDQKVSAQKNMHKMARRIVKYGGLTSRFFYWN 334 Query: 130 SRWIRR 135 + R+ Sbjct: 335 GKMYRK 340 >ref|NP_658788.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847202.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP28688.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 354 Score = 112 bits (280), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 71/126 (56%) Query: 10 KLSTSAAASIRAAYFPHLCGLHIMLDYLIDQDEDRAGGDLNFCNYYDTSDTMLNRIASIV 69 +L A IR YFP++ GLHI+LDY IDQ+EDR GGDLNFC+YY+ +L+R+ V Sbjct: 225 ELHDEDIAKIRQGYFPYVQGLHILLDYFIDQEEDRIGGDLNFCSYYENEQVILDRMKHFV 284 Query: 70 EWARRDVRNLPETSMHRMVIEGLLALYLSDPKXXXXXXXXXXXXXXXXXXPLTRLFFFVN 129 E A + + +LP HR++ GLL +YLSD K LT FF+ N Sbjct: 285 EEAEKSIGDLPHAKFHRLISRGLLGIYLSDQKVSAQKNMHKMARRIVKYGGLTSRFFYWN 344 Query: 130 SRWIRR 135 + R+ Sbjct: 345 GKMYRK 350 >ref|NP_834456.1| hypothetical protein [Bacillus cereus ATCC 14579] gb|AAP11657.1| hypothetical protein [Bacillus cereus ATCC 14579] Length = 354 Score = 112 bits (280), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 71/126 (56%) Query: 10 KLSTSAAASIRAAYFPHLCGLHIMLDYLIDQDEDRAGGDLNFCNYYDTSDTMLNRIASIV 69 +L A IR YFP++ GLHI+LDY IDQ+EDR GGDLNFC+YY+ +L+R+ V Sbjct: 225 ELHDEDIAKIRQGYFPYVQGLHILLDYFIDQEEDRIGGDLNFCSYYENEQAILDRMKHFV 284 Query: 70 EWARRDVRNLPETSMHRMVIEGLLALYLSDPKXXXXXXXXXXXXXXXXXXPLTRLFFFVN 129 E A + + +LP HR++ GLL +YLSD K LT FF+ N Sbjct: 285 EEAEKSIGDLPHAKFHRLISRGLLGIYLSDQKVSAQKNMHKMARRIVKYGGLTSRFFYWN 344 Query: 130 SRWIRR 135 + R+ Sbjct: 345 GKMYRK 350 >ref|NP_390928.1| ytpB [Bacillus subtilis] sp|O34707|YTPB_BACSU Hypothetical protein ytpB pir||E69998 hypothetical protein ytpB - Bacillus subtilis gb|AAC00246.1| YtpB [Bacillus subtilis] emb|CAB15028.1| ytpB [Bacillus subtilis subsp. subtilis str. 168] Length = 367 Score = 110 bits (276), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 51/130 (39%), Positives = 74/130 (56%) Query: 6 SCDPKLSTSAAASIRAAYFPHLCGLHIMLDYLIDQDEDRAGGDLNFCNYYDTSDTMLNRI 65 S P + S A IR +YFP++ GLHI+LDYLIDQ+ED GDLNFC+YY + + M++R+ Sbjct: 220 SFQPDFTESTAKKIRDSYFPYIQGLHILLDYLIDQEEDLLEGDLNFCSYYQSHEEMMDRL 279 Query: 66 ASIVEWARRDVRNLPETSMHRMVIEGLLALYLSDPKXXXXXXXXXXXXXXXXXXPLTRLF 125 + A ++ +P + HR++ GLL +YLSD K T LF Sbjct: 280 EHFIHKADEHLQGIPHENFHRLINRGLLGVYLSDDKVAGQKEMGRLAKKLIKASGKTSLF 339 Query: 126 FFVNSRWIRR 135 F++N R R+ Sbjct: 340 FYINGRAYRK 349 >ref|ZP_00112480.1| hypothetical protein [Nostoc punctiforme] Length = 381 Score = 94.7 bits (234), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 47/122 (38%), Positives = 62/122 (50%) Query: 8 DPKLSTSAAASIRAAYFPHLCGLHIMLDYLIDQDEDRAGGDLNFCNYYDTSDTMLNRIAS 67 D S A ++ +YFP + GLHI+LDY IDQ+EDR GGDLNFC YY+ + R A Sbjct: 246 DQDCSEELATKVKNSYFPWVQGLHILLDYFIDQEEDRIGGDLNFCAYYNNGQEISERFAY 305 Query: 68 IVEWARRDVRNLPETSMHRMVIEGLLALYLSDPKXXXXXXXXXXXXXXXXXXPLTRLFFF 127 ++ A + V LP HRM+ LL +YL+D K + LFF Sbjct: 306 FLKQADKAVSRLPHDRFHRMINRALLGVYLADEKVNQQENIKETAKKILSSCGGSSLFFM 365 Query: 128 VN 129 N Sbjct: 366 WN 367 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 173,157,388 Number of extensions: 5418525 Number of successful extensions: 12184 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 12182 Number of HSP's successfully gapped: 8 Length of query: 138 Length of database: 757,237,578 Length adjustment: 99 Effective length of query: 39 Effective length of database: 488,442,777 Effective search space: 19049268303 Effective search space used: 19049268303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 120 (50.8 bits)