BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0340.0008.p (198 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00049970.1| COG3707: Response regulator with putative ant... 71 2e-11 ref|NP_437234.1| putative response regulator protein [Sinorhizob... 66 5e-10 ref|NP_534399.1| two component response regulator [Agrobacterium... 66 5e-10 ref|NP_356727.1| AGR_L_1879p [Agrobacterium tumefaciens] >gi|255... 66 6e-10 ref|NP_104095.1| two-component response regulator [Mesorhizobium... 65 9e-10 >ref|ZP_00049970.1| COG3707: Response regulator with putative antiterminator output domain [Magnetospirillum magnetotacticum] Length = 251 Score = 70.9 bits (172), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 45/110 (40%), Positives = 67/110 (60%), Gaps = 9/110 (8%) Query: 85 ATADLSVTACGDDIMVDGILSPSMQPQEIHWILHFSARQCFERQQWLKEREQLLSRIEER 144 A D ++A +VDG+ + ++P IL F+A F R Q +E ++ S + +R Sbjct: 150 AAVDAGISAY----VVDGLRAERIKPILDIAILRFNA---FARLQ--RELDEARSELADR 200 Query: 145 KWIDMAKGILSKAKNISESEAYDLLRKQAMNERKRMVDVATSIVKVYQLL 194 K I+ AKGIL K +SE EAY LLR+QAMNE++++VD+A +IV LL Sbjct: 201 KLIERAKGILMTRKGMSEEEAYKLLRRQAMNEKRKIVDIARAIVTAADLL 250 >ref|NP_437234.1| putative response regulator protein [Sinorhizobium meliloti 1021] pir||F95928 probable response regulator protein [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB emb|CAC49094.1| putative response regulator protein [Sinorhizobium meliloti] Length = 162 Score = 65.9 bits (159), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 8/121 (6%) Query: 77 PILWWCT---TATADLSVTACGDDIMVDGILSPSMQPQEIHWILHFSARQCFERQQWLKE 133 PI + TA+ + +V A +VDG+ ++P + F A F R Q +E Sbjct: 45 PIAMFVDRSDTASIEAAVEAGVSAYIVDGLKKERVKPILDMAVSRFKA---FSRLQ--RE 99 Query: 134 REQLLSRIEERKWIDMAKGILSKAKNISESEAYDLLRKQAMNERKRMVDVATSIVKVYQL 193 + S +EERK ++ AKGIL K + +SE EA+ LLR+ AMNE+K++ ++A S+V L Sbjct: 100 LAEAKSALEERKLVERAKGILMKMRGLSEDEAFALLRQTAMNEKKKISEIAQSVVTAAGL 159 Query: 194 L 194 L Sbjct: 160 L 160 >ref|NP_534399.1| two component response regulator [Agrobacterium tumefaciens str. C58 (U. Washington)] pir||AE3037 two component response regulator nasT [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gb|AAL44715.1| two component response regulator [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 195 Score = 65.9 bits (159), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 8/121 (6%) Query: 77 PILWWCT---TATADLSVTACGDDIMVDGILSPSMQPQEIHWILHFSARQCFERQQWLKE 133 PI + TA+ + +V A +VDG+ ++P + F+A F R Q +E Sbjct: 79 PIAMFVDRSDTASIEAAVEAGVSAYVVDGLKKERVKPILDMAVSRFNA---FSRLQ--RE 133 Query: 134 REQLLSRIEERKWIDMAKGILSKAKNISESEAYDLLRKQAMNERKRMVDVATSIVKVYQL 193 S +EERK I+ AKGIL K + +SE EA+ LLR+ AMNE+K++ ++A S+V L Sbjct: 134 LADAKSALEERKVIERAKGILMKMRGLSEEEAFALLRQTAMNEKKKISEIAQSVVTAAGL 193 Query: 194 L 194 L Sbjct: 194 L 194 >ref|NP_356727.1| AGR_L_1879p [Agrobacterium tumefaciens] pir||F98248 response regulator nasT [imported] - Agrobacterium tumefaciens (strain C58, Cereon) gb|AAK89512.1| AGR_L_1879p [Agrobacterium tumefaciens str. C58 (Cereon)] Length = 204 Score = 65.9 bits (159), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 8/121 (6%) Query: 77 PILWWCT---TATADLSVTACGDDIMVDGILSPSMQPQEIHWILHFSARQCFERQQWLKE 133 PI + TA+ + +V A +VDG+ ++P + F+A F R Q +E Sbjct: 88 PIAMFVDRSDTASIEAAVEAGVSAYVVDGLKKERVKPILDMAVSRFNA---FSRLQ--RE 142 Query: 134 REQLLSRIEERKWIDMAKGILSKAKNISESEAYDLLRKQAMNERKRMVDVATSIVKVYQL 193 S +EERK I+ AKGIL K + +SE EA+ LLR+ AMNE+K++ ++A S+V L Sbjct: 143 LADAKSALEERKVIERAKGILMKMRGLSEEEAFALLRQTAMNEKKKISEIAQSVVTAAGL 202 Query: 194 L 194 L Sbjct: 203 L 203 >ref|NP_104095.1| two-component response regulator [Mesorhizobium loti MAFF303099] dbj|BAB49881.1| two-component response regulator [Mesorhizobium loti] Length = 216 Score = 65.1 bits (157), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 44/121 (36%), Positives = 66/121 (54%), Gaps = 8/121 (6%) Query: 77 PILWWCTT---ATADLSVTACGDDIMVDGILSPSMQPQEIHWILHFSARQCFERQQWLKE 133 PI + A+ + +V A +VDG+ ++P + F+A F R +E Sbjct: 95 PIAMFVDRSDQASIEAAVDAGVSAYVVDGLRQERVKPILDMAVSRFNA---FSR--MARE 149 Query: 134 REQLLSRIEERKWIDMAKGILSKAKNISESEAYDLLRKQAMNERKRMVDVATSIVKVYQL 193 E+ S +E RK ID AKGIL K++ +SE AY LLRK AMN+ +++ D+A S+V L Sbjct: 150 LEEARSELESRKVIDRAKGILIKSRGLSEEAAYTLLRKTAMNQNRKISDIAQSLVTAAGL 209 Query: 194 L 194 L Sbjct: 210 L 210 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.129 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 264,477,298 Number of extensions: 9415568 Number of successful extensions: 27942 Number of sequences better than 1.0e-05: 24 Number of HSP's gapped: 27943 Number of HSP's successfully gapped: 24 Length of query: 198 Length of database: 757,237,578 Length adjustment: 119 Effective length of query: 79 Effective length of database: 434,140,797 Effective search space: 34297122963 Effective search space used: 34297122963 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 123 (52.0 bits)