BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0337.0018.p (51 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_658517.1| HTH_LUXR, helix_turn_helix, Lux Regulon [Bacill... 88 8e-17 ref|NP_243941.1| transcriptional regulator of spore coat protein... 86 2e-16 ref|NP_693031.1| transcriptional regulator [Oceanobacillus iheye... 86 3e-16 ref|NP_390719.1| transcriptional regulator [Bacillus subtilis] >... 85 4e-16 pdb|1FSE|A Chain A, Crystal Structure Of The Bacillus Subtilis R... 85 4e-16 >ref|NP_658517.1| HTH_LUXR, helix_turn_helix, Lux Regulon [Bacillus anthracis A2012] ref|NP_834211.1| Germination protein gerE [Bacillus cereus ATCC 14579] ref|NP_846935.1| germination protein GerE [Bacillus anthracis str. Ames] gb|AAP11412.1| Germination protein gerE [Bacillus cereus ATCC 14579] gb|AAP28421.1| germination protein GerE [Bacillus anthracis str. Ames] Length = 74 Score = 87.8 bits (216), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 41/51 (80%), Positives = 48/51 (94%) Query: 1 VQDKTTRDIAGLLFISEKTVRNHISNVMQKLNVKGRSQAVVELIKLGELKI 51 VQDKTT++IAG LFISEKTVRNHISN MQKL VKGRSQAVVEL+++GEL++ Sbjct: 24 VQDKTTKEIAGELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 >ref|NP_243941.1| transcriptional regulator of spore coat protein (spore germination protein) [Bacillus halodurans] pir||C84034 transcription regulator of spore coat protein (spore germination protein) gerE [imported] - Bacillus halodurans (strain C-125) dbj|BAB06794.1| transcriptional regulator of spore coat protein (spore germination protein) [Bacillus halodurans] Length = 74 Score = 86.3 bits (212), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 42/51 (82%), Positives = 47/51 (92%) Query: 1 VQDKTTRDIAGLLFISEKTVRNHISNVMQKLNVKGRSQAVVELIKLGELKI 51 VQDKTT++IA LFISEKTVRNHISN MQKL VKGRSQAV+ELI+LGEL+I Sbjct: 24 VQDKTTKEIAEQLFISEKTVRNHISNTMQKLGVKGRSQAVIELIRLGELEI 74 >ref|NP_693031.1| transcriptional regulator [Oceanobacillus iheyensis HTE831] dbj|BAC14066.1| transcriptional regulator [Oceanobacillus iheyensis HTE831] Length = 74 Score = 85.5 bits (210), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 41/51 (80%), Positives = 47/51 (92%) Query: 1 VQDKTTRDIAGLLFISEKTVRNHISNVMQKLNVKGRSQAVVELIKLGELKI 51 VQDKTT++IA LFISEKTVRNHISN MQKL VKGRSQAVVEL+++GELK+ Sbjct: 24 VQDKTTKEIAQELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELKL 74 >ref|NP_390719.1| transcriptional regulator [Bacillus subtilis] sp|P11470|GERE_BACSU Germination protein gerE pir||C27893 transcription regulator gerE - Bacillus subtilis gb|AAA22473.1| germination protein (ttg start codon) emb|CAA99550.1| transcriptional regulator of spore coat genes [Bacillus subtilis] emb|CAB14801.1| transcriptional regulator [Bacillus subtilis subsp. subtilis str. 168] Length = 74 Score = 85.1 bits (209), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 40/51 (78%), Positives = 47/51 (92%) Query: 1 VQDKTTRDIAGLLFISEKTVRNHISNVMQKLNVKGRSQAVVELIKLGELKI 51 VQDKTT++IA LFISEKTVRNHISN MQKL VKGRSQAVVEL+++GEL++ Sbjct: 24 VQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 >pdb|1FSE|A Chain A, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere pdb|1FSE|B Chain B, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere pdb|1FSE|C Chain C, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere pdb|1FSE|D Chain D, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere pdb|1FSE|E Chain E, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere pdb|1FSE|F Chain F, Crystal Structure Of The Bacillus Subtilis Regulatory Protein Gere emb|CAA11701.1| GerE [Bacillus subtilis] Length = 74 Score = 85.1 bits (209), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 40/51 (78%), Positives = 47/51 (92%) Query: 1 VQDKTTRDIAGLLFISEKTVRNHISNVMQKLNVKGRSQAVVELIKLGELKI 51 VQDKTT++IA LFISEKTVRNHISN MQKL VKGRSQAVVEL+++GEL++ Sbjct: 24 VQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 74 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.134 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 56,993,893 Number of extensions: 1272095 Number of successful extensions: 5901 Number of sequences better than 1.0e-05: 11 Number of HSP's gapped: 5904 Number of HSP's successfully gapped: 11 Length of query: 51 Length of database: 757,237,578 Length adjustment: 24 Effective length of query: 27 Effective length of database: 692,075,202 Effective search space: 18686030454 Effective search space used: 18686030454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)