BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0333.0015.p
         (62 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|ZP_00180131.1| hypothetical protein Mther193801 [Moorella th...    52   5e-06

>ref|ZP_00180131.1| hypothetical protein Mther193801 [Moorella thermoacetica ATCC
          39073]
          Length = 69

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 1  MWTVIYIAPTARVADMIQSKLTEEGFLIKCRPVNMSKQQ----FEILVPSGELEEVQEAL 56
          MWTVIYIA   ++A  ++  LT+EG ++  RP+  S+ +    +E+LVP  E EE  E +
Sbjct: 4  MWTVIYIAANRKLALRLKETLTQEGVMVNLRPIGSSQAEDLAGYEVLVPESEAEEANEII 63

Query: 57 NLIL 60
          +  L
Sbjct: 64 SAAL 67


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.321    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 82,004,615
Number of extensions: 2239400
Number of successful extensions: 5122
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 5121
Number of HSP's successfully gapped: 1
Length of query: 62
Length of database: 757,237,578
Length adjustment: 34
Effective length of query: 28
Effective length of database: 664,924,212
Effective search space: 18617877936
Effective search space used: 18617877936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 120 (50.8 bits)